Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05605
Gene name
Locationscaffold_06:662474..663311
Strand+
Gene length (bp)837
Transcript length (bp)783
Coding sequence length (bp)783
Protein length (aa) 261

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08552 Kei1 Inositolphosphorylceramide synthase subunit Kei1 6.4E-50 16 189

GO

GO Term Description Terminal node
GO:0070917 inositol phosphoceramide synthase regulator activity Yes
GO:0006673 inositol phosphoceramide metabolic process Yes
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0006643 membrane lipid metabolic process No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0006665 sphingolipid metabolic process No
GO:0044255 cellular lipid metabolic process No
GO:0098772 molecular function regulator activity No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006629 lipid metabolic process No
GO:0003674 molecular_function No
GO:0006644 phospholipid metabolic process No
GO:0030234 enzyme regulator activity No
GO:0006796 phosphate-containing compound metabolic process No
GO:0008150 biological_process No
GO:0006793 phosphorus metabolic process No
GO:0019637 organophosphate metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.5

Transmembrane Domains

Domain # Start End Length
1 54 76 22
2 88 110 22
3 160 182 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05605
MARFTRLMGRVPRPQSLFGVISLQTGTELIALAQVFNKVTGVYGLLAILTGYKLSVLQLSTYLYSIAILAVVVYL
IPHVRRQSPVECLALAHVYLIDTIVNCIYTAAFGLELYSASTSISNAEERPSPSLSTIVTKGFSGLRREGDAPVK
AAVPQETATSMLLIVGLTLLRIYFSTVVTSYAQQVIQRYAQIQAVESPGVDDEDGPFSPHFPAGEGRRGRMGRML
VSCGRGYWLGTKEALFWRTEWQSKPIAGATLAGEV*
Coding >Ophcf2|05605
ATGGCGAGATTTACGAGGCTGATGGGACGCGTGCCCCGCCCCCAGAGCCTATTCGGCGTCATCAGCCTCCAGACA
GGTACCGAGCTCATCGCGCTGGCCCAGGTCTTCAACAAGGTCACCGGAGTTTACGGTCTGCTCGCCATCCTCACC
GGCTACAAGCTATCGGTGCTGCAGCTGTCGACATATCTCTACTCCATAGCTATCCTCGCCGTCGTTGTCTATCTG
ATTCCCCACGTCCGACGGCAAAGCCCGGTGGAATGTCTGGCCCTGGCCCACGTCTATCTTATCGACACCATCGTC
AACTGCATCTACACGGCCGCCTTTGGCCTGGAGCTTTATTCTGCCAGTACCAGCATAAGCAACGCCGAGGAGCGG
CCGTCACCGTCGCTCTCCACCATCGTCACCAAGGGCTTCAGCGGGCTGCGACGAGAGGGTGATGCTCCGGTCAAG
GCGGCAGTACCGCAGGAGACGGCGACGAGCATGCTCCTGATAGTGGGACTGACGCTCCTCAGAATATACTTCAGC
ACCGTCGTCACGTCATACGCGCAACAAGTCATTCAGAGGTATGCTCAAATACAGGCCGTTGAGAGTCCCGGAGTC
GACGACGAAGACGGCCCATTCTCACCCCATTTCCCCGCCGGCGAGGGACGTAGAGGACGGATGGGAAGGATGCTG
GTGTCTTGCGGCAGAGGATACTGGCTGGGCACCAAAGAGGCCCTATTCTGGCGTACAGAGTGGCAGAGCAAGCCA
ATAGCCGGGGCAACGTTGGCGGGAGAGGTTTAG
Transcript >Ophcf2|05605
ATGGCGAGATTTACGAGGCTGATGGGACGCGTGCCCCGCCCCCAGAGCCTATTCGGCGTCATCAGCCTCCAGACA
GGTACCGAGCTCATCGCGCTGGCCCAGGTCTTCAACAAGGTCACCGGAGTTTACGGTCTGCTCGCCATCCTCACC
GGCTACAAGCTATCGGTGCTGCAGCTGTCGACATATCTCTACTCCATAGCTATCCTCGCCGTCGTTGTCTATCTG
ATTCCCCACGTCCGACGGCAAAGCCCGGTGGAATGTCTGGCCCTGGCCCACGTCTATCTTATCGACACCATCGTC
AACTGCATCTACACGGCCGCCTTTGGCCTGGAGCTTTATTCTGCCAGTACCAGCATAAGCAACGCCGAGGAGCGG
CCGTCACCGTCGCTCTCCACCATCGTCACCAAGGGCTTCAGCGGGCTGCGACGAGAGGGTGATGCTCCGGTCAAG
GCGGCAGTACCGCAGGAGACGGCGACGAGCATGCTCCTGATAGTGGGACTGACGCTCCTCAGAATATACTTCAGC
ACCGTCGTCACGTCATACGCGCAACAAGTCATTCAGAGGTATGCTCAAATACAGGCCGTTGAGAGTCCCGGAGTC
GACGACGAAGACGGCCCATTCTCACCCCATTTCCCCGCCGGCGAGGGACGTAGAGGACGGATGGGAAGGATGCTG
GTGTCTTGCGGCAGAGGATACTGGCTGGGCACCAAAGAGGCCCTATTCTGGCGTACAGAGTGGCAGAGCAAGCCA
ATAGCCGGGGCAACGTTGGCGGGAGAGGTTTAG
Gene >Ophcf2|05605
ATGGCGAGATTTACGAGGCTGATGGGACGCGTGCCCCGCCCCCAGGTTTGCAGACCCAAACGATCCAGGATACGA
GCAATGCGCTAATGCAGTTGACAGAGCCTATTCGGCGTCATCAGCCTCCAGACAGGTACCGAGCTCATCGCGCTG
GCCCAGGTCTTCAACAAGGTCACCGGAGTTTACGGTCTGCTCGCCATCCTCACCGGCTACAAGCTATCGGTGCTG
CAGCTGTCGACATATCTCTACTCCATAGCTATCCTCGCCGTCGTTGTCTATCTGATTCCCCACGTCCGACGGCAA
AGCCCGGTGGAATGTCTGGCCCTGGCCCACGTCTATCTTATCGACACCATCGTCAACTGCATCTACACGGCCGCC
TTTGGCCTGGAGCTTTATTCTGCCAGTACCAGCATAAGCAACGCCGAGGAGCGGCCGTCACCGTCGCTCTCCACC
ATCGTCACCAAGGGCTTCAGCGGGCTGCGACGAGAGGGTGATGCTCCGGTCAAGGCGGCAGTACCGCAGGAGACG
GCGACGAGCATGCTCCTGATAGTGGGACTGACGCTCCTCAGAATATACTTCAGCACCGTCGTCACGTCATACGCG
CAACAAGTCATTCAGAGGTATGCTCAAATACAGGCCGTTGAGAGTCCCGGAGTCGACGACGAAGACGGCCCATTC
TCACCCCATTTCCCCGCCGGCGAGGGACGTAGAGGACGGATGGGAAGGATGCTGGTGTCTTGCGGCAGAGGATAC
TGGCTGGGCACCAAAGAGGCCCTATTCTGGCGTACAGAGTGGCAGAGCAAGCCAATAGCCGGGGCAACGTTGGCG
GGAGAGGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail