Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05604
Gene name
Locationscaffold_06:660976..661969
Strand-
Gene length (bp)993
Transcript length (bp)993
Coding sequence length (bp)993
Protein length (aa) 331

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00929 RNase_T Exonuclease 2.2E-13 133 283

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.1803 0.8333 0.0586 0.0065 0.179 0.0163 0.0269 0.0069 0.0431 0.0064

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5716
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7128
Ophiocordyceps australis map64 (Brazil) OphauB2|1135
Ophiocordyceps camponoti-floridani Ophcf2|05604 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7317
Ophiocordyceps kimflemingae Ophio5|6446
Ophiocordyceps subramaniannii Hirsu2|8963

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05604
MVDLSSNWKKLKALLNTEKAPTSRSKRKADNSSTPQRQGKSRKLAIKPITTTHKRDTNRSNRPSMGGVHSSPINL
QSRNGLSTSIALWTGDDQVSSETLADAYKLGLKGDATVKKTDRLNHGLSQDITVGKFVALDCEMVGVGLGGRESA
LARVSVVDFHGQQIYDSFVKPEEIVTNWRTSVSGVSPEDMRLARKFKDVQAQISNLLKDRVLVGHDIKHDLTALK
LSHPNRDTRDTALHPGFKQWAYGRKPALRVLAKELLGTNLHDGAHSSVEDARATMLLFRKHKSDFDADNAKRFPP
KKVGTTQGKGKKAVKAKKRKPPKKAKDQWG*
Coding >Ophcf2|05604
ATGGTCGACTTGTCTTCAAACTGGAAGAAGTTGAAAGCTCTCCTCAACACCGAAAAGGCTCCGACATCCCGATCA
AAACGAAAGGCCGATAACTCGTCCACTCCTCAGCGTCAAGGCAAGAGCCGGAAACTCGCCATCAAGCCCATCACT
ACCACCCACAAACGAGACACAAATCGATCGAACCGACCCAGCATGGGCGGTGTGCACAGCTCTCCCATTAATCTC
CAATCTCGAAACGGCCTTTCCACCTCAATTGCTCTGTGGACCGGAGACGACCAAGTCTCCTCTGAAACACTGGCT
GATGCCTACAAGCTTGGTCTCAAGGGAGACGCCACGGTTAAGAAAACCGATCGTCTCAACCACGGTCTCTCTCAA
GATATAACAGTGGGAAAATTCGTGGCCTTGGACTGCGAGATGGTGGGCGTCGGCTTGGGTGGTCGCGAGTCGGCG
CTGGCTAGAGTCAGCGTCGTCGACTTCCACGGGCAACAAATATACGACTCGTTTGTGAAGCCGGAAGAGATCGTG
ACTAACTGGAGGACCTCAGTGAGCGGCGTCTCCCCCGAGGACATGCGACTGGCACGGAAATTCAAAGATGTTCAA
GCTCAGATATCTAATCTTCTAAAAGATCGAGTGTTGGTGGGGCACGACATTAAACATGACCTGACGGCTCTCAAG
CTCAGCCACCCAAACCGGGATACTCGTGATACCGCACTGCACCCCGGCTTCAAGCAGTGGGCATACGGTCGAAAA
CCAGCTCTGAGGGTGCTGGCGAAAGAACTGCTCGGCACGAACCTACACGATGGAGCCCATTCCAGTGTCGAGGAT
GCCCGGGCCACGATGCTTCTTTTTCGCAAGCACAAGTCCGACTTCGATGCCGACAATGCCAAACGGTTCCCTCCG
AAGAAAGTTGGAACGACCCAGGGCAAAGGGAAGAAGGCGGTCAAGGCCAAGAAACGAAAACCTCCGAAGAAGGCA
AAAGACCAGTGGGGTTGA
Transcript >Ophcf2|05604
ATGGTCGACTTGTCTTCAAACTGGAAGAAGTTGAAAGCTCTCCTCAACACCGAAAAGGCTCCGACATCCCGATCA
AAACGAAAGGCCGATAACTCGTCCACTCCTCAGCGTCAAGGCAAGAGCCGGAAACTCGCCATCAAGCCCATCACT
ACCACCCACAAACGAGACACAAATCGATCGAACCGACCCAGCATGGGCGGTGTGCACAGCTCTCCCATTAATCTC
CAATCTCGAAACGGCCTTTCCACCTCAATTGCTCTGTGGACCGGAGACGACCAAGTCTCCTCTGAAACACTGGCT
GATGCCTACAAGCTTGGTCTCAAGGGAGACGCCACGGTTAAGAAAACCGATCGTCTCAACCACGGTCTCTCTCAA
GATATAACAGTGGGAAAATTCGTGGCCTTGGACTGCGAGATGGTGGGCGTCGGCTTGGGTGGTCGCGAGTCGGCG
CTGGCTAGAGTCAGCGTCGTCGACTTCCACGGGCAACAAATATACGACTCGTTTGTGAAGCCGGAAGAGATCGTG
ACTAACTGGAGGACCTCAGTGAGCGGCGTCTCCCCCGAGGACATGCGACTGGCACGGAAATTCAAAGATGTTCAA
GCTCAGATATCTAATCTTCTAAAAGATCGAGTGTTGGTGGGGCACGACATTAAACATGACCTGACGGCTCTCAAG
CTCAGCCACCCAAACCGGGATACTCGTGATACCGCACTGCACCCCGGCTTCAAGCAGTGGGCATACGGTCGAAAA
CCAGCTCTGAGGGTGCTGGCGAAAGAACTGCTCGGCACGAACCTACACGATGGAGCCCATTCCAGTGTCGAGGAT
GCCCGGGCCACGATGCTTCTTTTTCGCAAGCACAAGTCCGACTTCGATGCCGACAATGCCAAACGGTTCCCTCCG
AAGAAAGTTGGAACGACCCAGGGCAAAGGGAAGAAGGCGGTCAAGGCCAAGAAACGAAAACCTCCGAAGAAGGCA
AAAGACCAGTGGGGTTGA
Gene >Ophcf2|05604
ATGGTCGACTTGTCTTCAAACTGGAAGAAGTTGAAAGCTCTCCTCAACACCGAAAAGGCTCCGACATCCCGATCA
AAACGAAAGGCCGATAACTCGTCCACTCCTCAGCGTCAAGGCAAGAGCCGGAAACTCGCCATCAAGCCCATCACT
ACCACCCACAAACGAGACACAAATCGATCGAACCGACCCAGCATGGGCGGTGTGCACAGCTCTCCCATTAATCTC
CAATCTCGAAACGGCCTTTCCACCTCAATTGCTCTGTGGACCGGAGACGACCAAGTCTCCTCTGAAACACTGGCT
GATGCCTACAAGCTTGGTCTCAAGGGAGACGCCACGGTTAAGAAAACCGATCGTCTCAACCACGGTCTCTCTCAA
GATATAACAGTGGGAAAATTCGTGGCCTTGGACTGCGAGATGGTGGGCGTCGGCTTGGGTGGTCGCGAGTCGGCG
CTGGCTAGAGTCAGCGTCGTCGACTTCCACGGGCAACAAATATACGACTCGTTTGTGAAGCCGGAAGAGATCGTG
ACTAACTGGAGGACCTCAGTGAGCGGCGTCTCCCCCGAGGACATGCGACTGGCACGGAAATTCAAAGATGTTCAA
GCTCAGATATCTAATCTTCTAAAAGATCGAGTGTTGGTGGGGCACGACATTAAACATGACCTGACGGCTCTCAAG
CTCAGCCACCCAAACCGGGATACTCGTGATACCGCACTGCACCCCGGCTTCAAGCAGTGGGCATACGGTCGAAAA
CCAGCTCTGAGGGTGCTGGCGAAAGAACTGCTCGGCACGAACCTACACGATGGAGCCCATTCCAGTGTCGAGGAT
GCCCGGGCCACGATGCTTCTTTTTCGCAAGCACAAGTCCGACTTCGATGCCGACAATGCCAAACGGTTCCCTCCG
AAGAAAGTTGGAACGACCCAGGGCAAAGGGAAGAAGGCGGTCAAGGCCAAGAAACGAAAACCTCCGAAGAAGGCA
AAAGACCAGTGGGGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail