Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05603
Gene name
Locationscaffold_06:659243..660878
Strand+
Gene length (bp)1635
Transcript length (bp)1446
Coding sequence length (bp)1446
Protein length (aa) 482

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02353 CMAS Mycolic acid cyclopropane synthetase 3.3E-70 175 459
PF13649 Methyltransf_25 Methyltransferase domain 1.1E-11 240 337
PF08241 Methyltransf_11 Methyltransferase domain 1.1E-10 241 339
PF13489 Methyltransf_23 Methyltransferase domain 8.9E-07 222 346

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Golgi apparatus 0.3339 0.2633 0.2365 0.0684 0.3716 0.1132 0.3682 0.2686 0.615 0.0312

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5717
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7127
Ophiocordyceps australis map64 (Brazil) OphauB2|1136
Ophiocordyceps camponoti-floridani Ophcf2|05603 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7318
Ophiocordyceps kimflemingae Ophio5|6445
Ophiocordyceps subramaniannii Hirsu2|8964

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05603
MSSFIRSMPSLPAALAWPVSQGAEMLRGTLGGWTWGPALAVAKPAIFAVLSRIETGSLLLIDEPAAETHVFGQKF
PGKLNGLSTRTAPSRSASAVPRVELVVRNDAFWMRLFLFADMGFAEAYMLGDFECEDLTSFFKMFIVNRDRMNNG
TTAFSSIASAVSSLARSTNTLSNSLLNISAHYDISNDMFAAFLSPDMTYSCPVWRPQIESDPNDESLEEAQIRKL
VRFIDGAKIKSSDHVLEIGTGWGSFAIEAVRRTKCRVTSLTLSAEQKHLAEKRIRAAGLDDRIDVMLMDYRQLPI
PTTPYDKVVSIEMLEAVGQDFLATYFACVNRLLKKRGGIAMFQCITMPEGRHKAYSRSEDFINHYIFPGGYLPSI
TQILNHISQQSDGSLIVENVENIGGHYARTLRLWNEEFRRNFDAQIRPALLHEHPDMTEKAVDVFRRKWEYYFTY
CEAGFLTKTLGDVIITVGREGALELMEEIPL*
Coding >Ophcf2|05603
ATGTCTTCCTTCATCAGGTCCATGCCGTCTCTGCCTGCTGCCCTGGCATGGCCCGTCTCCCAAGGCGCCGAGATG
CTGCGCGGTACGCTCGGGGGCTGGACATGGGGGCCTGCTCTCGCCGTCGCCAAGCCTGCCATCTTCGCCGTCCTT
TCCCGCATTGAGACCGGCTCTTTGCTCCTCATCGACGAACCCGCTGCCGAAACACACGTATTTGGGCAAAAGTTC
CCGGGCAAGCTGAACGGTCTTTCGACTAGGACAGCTCCGTCAAGGTCCGCCAGCGCCGTTCCTCGTGTCGAGCTC
GTTGTGAGAAATGATGCCTTTTGGATGCGCCTCTTTCTCTTTGCCGATATGGGATTCGCCGAGGCCTATATGCTT
GGCGACTTTGAATGTGAGGACTTGACCTCGTTCTTCAAGATGTTTATAGTAAATAGAGATCGGATGAACAACGGA
ACCACTGCCTTCTCCAGCATCGCATCTGCCGTATCCAGCCTGGCTCGATCGACGAATACGCTATCCAACTCGCTT
TTGAACATATCGGCCCATTATGACATTAGCAACGACATGTTCGCCGCCTTCCTGTCGCCAGACATGACGTATTCG
TGCCCGGTCTGGAGGCCACAGATCGAATCTGATCCCAACGATGAAAGTCTCGAGGAGGCTCAGATTAGAAAGCTC
GTTCGGTTCATCGATGGCGCCAAGATCAAATCCTCCGATCACGTCCTCGAAATCGGTACAGGCTGGGGCTCTTTC
GCCATAGAGGCAGTTCGGAGGACAAAATGCCGCGTCACTAGCCTTACGCTCTCCGCAGAACAGAAGCACCTGGCC
GAGAAGAGAATTCGAGCCGCGGGCCTCGACGACCGCATAGACGTGATGCTAATGGATTATCGCCAGCTGCCGATA
CCGACGACGCCGTACGACAAGGTCGTCTCTATAGAAATGCTGGAAGCCGTCGGTCAAGACTTTTTGGCCACATAC
TTTGCGTGCGTGAACCGGCTACTCAAGAAGCGTGGCGGCATCGCCATGTTTCAGTGCATCACCATGCCGGAGGGT
CGTCACAAGGCGTATTCCAGGTCTGAGGACTTCATCAATCACTACATCTTTCCCGGCGGCTACCTGCCATCGATA
ACCCAAATATTGAATCACATCAGTCAACAGTCGGACGGCTCTTTGATTGTGGAAAATGTAGAAAACATCGGCGGC
CACTATGCGCGTACGCTGAGACTTTGGAATGAGGAGTTTCGGCGGAATTTCGACGCCCAAATCAGACCTGCTCTT
CTCCACGAGCACCCCGACATGACAGAGAAAGCCGTCGACGTCTTTCGTCGAAAATGGGAGTATTACTTCACGTAC
TGCGAAGCTGGATTCCTGACGAAAACCTTGGGCGACGTTATCATCACTGTTGGGCGAGAGGGTGCTTTGGAACTG
ATGGAAGAAATCCCGCTTTGA
Transcript >Ophcf2|05603
ATGTCTTCCTTCATCAGGTCCATGCCGTCTCTGCCTGCTGCCCTGGCATGGCCCGTCTCCCAAGGCGCCGAGATG
CTGCGCGGTACGCTCGGGGGCTGGACATGGGGGCCTGCTCTCGCCGTCGCCAAGCCTGCCATCTTCGCCGTCCTT
TCCCGCATTGAGACCGGCTCTTTGCTCCTCATCGACGAACCCGCTGCCGAAACACACGTATTTGGGCAAAAGTTC
CCGGGCAAGCTGAACGGTCTTTCGACTAGGACAGCTCCGTCAAGGTCCGCCAGCGCCGTTCCTCGTGTCGAGCTC
GTTGTGAGAAATGATGCCTTTTGGATGCGCCTCTTTCTCTTTGCCGATATGGGATTCGCCGAGGCCTATATGCTT
GGCGACTTTGAATGTGAGGACTTGACCTCGTTCTTCAAGATGTTTATAGTAAATAGAGATCGGATGAACAACGGA
ACCACTGCCTTCTCCAGCATCGCATCTGCCGTATCCAGCCTGGCTCGATCGACGAATACGCTATCCAACTCGCTT
TTGAACATATCGGCCCATTATGACATTAGCAACGACATGTTCGCCGCCTTCCTGTCGCCAGACATGACGTATTCG
TGCCCGGTCTGGAGGCCACAGATCGAATCTGATCCCAACGATGAAAGTCTCGAGGAGGCTCAGATTAGAAAGCTC
GTTCGGTTCATCGATGGCGCCAAGATCAAATCCTCCGATCACGTCCTCGAAATCGGTACAGGCTGGGGCTCTTTC
GCCATAGAGGCAGTTCGGAGGACAAAATGCCGCGTCACTAGCCTTACGCTCTCCGCAGAACAGAAGCACCTGGCC
GAGAAGAGAATTCGAGCCGCGGGCCTCGACGACCGCATAGACGTGATGCTAATGGATTATCGCCAGCTGCCGATA
CCGACGACGCCGTACGACAAGGTCGTCTCTATAGAAATGCTGGAAGCCGTCGGTCAAGACTTTTTGGCCACATAC
TTTGCGTGCGTGAACCGGCTACTCAAGAAGCGTGGCGGCATCGCCATGTTTCAGTGCATCACCATGCCGGAGGGT
CGTCACAAGGCGTATTCCAGGTCTGAGGACTTCATCAATCACTACATCTTTCCCGGCGGCTACCTGCCATCGATA
ACCCAAATATTGAATCACATCAGTCAACAGTCGGACGGCTCTTTGATTGTGGAAAATGTAGAAAACATCGGCGGC
CACTATGCGCGTACGCTGAGACTTTGGAATGAGGAGTTTCGGCGGAATTTCGACGCCCAAATCAGACCTGCTCTT
CTCCACGAGCACCCCGACATGACAGAGAAAGCCGTCGACGTCTTTCGTCGAAAATGGGAGTATTACTTCACGTAC
TGCGAAGCTGGATTCCTGACGAAAACCTTGGGCGACGTTATCATCACTGTTGGGCGAGAGGGTGCTTTGGAACTG
ATGGAAGAAATCCCGCTTTGA
Gene >Ophcf2|05603
ATGTCTTCCTTCATCAGGTCCATGCCGTCTCTGCCTGCTGCCCTGGCATGGCCCGTCTCCCAAGGCGCCGAGATG
CTGCGCGGTACGCTCGGGGGCTGGACATGGGGGCCTGCTCTCGCCGTCGCCAAGCCTGCCATCTTCGCCGTCCTT
TCCCGCATTGAGACCGGCTCTTTGCTCCTCATCGACGAACCCGCTGCCGAAACACACGTATTTGGGCAAAAGTTC
CCGGGCAAGCTGAACGGTCTTTCGACTAGGACAGCTCCGTCAAGGTCCGCCAGCGCCGTTCCTCGTGTCGAGCTC
GTTGTGAGAAATGATGCCTTTTGGATGCGCCTCTTTCTCTTTGCCGATATGGGATTCGCCGAGGCCTATATGCTT
GGCGACTTTGAATGTGAGGACTTGACCTCGTTCTTCAAGGCAAGGGGCCTTCTCGTCACCGACTCCTCCCCTGAT
AGACTGTGGCTCACCACTTCGATAGATGTTTATAGTAAATAGAGATCGGATGAACAACGGAACCACTGCCTTCTC
CAGCATCGCATCTGCCGTATCCAGCCTGGCTCGATCGACGAATACGCTATCCAACTCGCTTTTGAACATATCGGC
CCATTATGACATTAGCAACGACATGTTCGCCGCCTTCCTGTCGCCAGACATGACGTATTCGTGCCCGGTCTGGAG
GCCACAGATCGAATCTGATCCCAACGATGAAAGTCTCGAGGAGGCTCAGATTAGAAAGCTCGTTCGGTTCATCGA
TGGCGCCAAGATCAAATCCTCCGATCACGTCCTCGAAATCGGTACAGGCTGGGGCTCTTTCGCCATAGAGGCAGT
TCGGAGGACAAAATGCCGCGTCACTAGCCTTACGCTCTCCGCAGAACAGAAGCACCTGGCCGAGAAGAGAATTCG
AGCCGCGGGCCTCGACGACCGCATAGACGTGATGCTAATGGATTATCGCCAGCTGCCGATACCGACGACGCCGTA
CGACAAGGTCGTCTCTATAGAAATGCTGGAAGCCGTCGGTCAAGACTTTTTGGCCACATACTTTGCGTGCGTGAA
CCGGCTACTCAAGAAGCGTGGCGGCATCGCCATGTTTCAGTGCATCACCATGCCGGAGGGTCGTCACAAGGCGTA
TTCCAGGTCTGAGGAGTGAGTGCCTCGATCAAAGATGGCCATATCGAGGGCCCTGAAACGACGACTGAGCTGACA
GACCGCGAAGCTTCATCAATCACTACATCTTTCCCGGCGGCTACCTGCCATCGATAACCCAAATATTGAATCACA
TCAGTCAACAGTCGGACGGCTCTTTGATTGTGGAAAATGTAGAAAACATCGGCGGCCACTATGCGCGTACGCTGA
GACTTTGGAATGAGGAGTTTCGGCGGAATTTCGACGCCCAAATCAGACCTGCTCTTCTCCACGAGCACCCCGACA
TGACAGAGAAAGCCGTCGACGTCTTTCGTCGAAAATGGGAGGTAGGCAGTGACGGTCTGGTTGTCCACGACACTC
TGACGCCTGACTGACTTGTTTTAGTATTACTTCACGTACTGCGAAGCTGGATTCCTGACGAAAACCTTGGGCGAC
GTTATCATCACTGTTGGGCGAGAGGGTGCTTTGGAACTGATGGAAGAAATCCCGCTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail