Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05602
Gene name
Locationscaffold_06:657892..658504
Strand-
Gene length (bp)612
Transcript length (bp)483
Coding sequence length (bp)483
Protein length (aa) 161

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08615 RNase_H2_suC Ribonuclease H2 non-catalytic subunit (Ylr154p-like) 3.5E-27 22 148

GO

GO Term Description Terminal node
GO:0032299 ribonuclease H2 complex Yes
GO:0006401 RNA catabolic process Yes
GO:0005575 cellular_component No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:0009056 catabolic process No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0034655 nucleobase-containing compound catabolic process No
GO:0044265 cellular macromolecule catabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0032991 protein-containing complex No
GO:1901360 organic cyclic compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0046700 heterocycle catabolic process No
GO:0009057 macromolecule catabolic process No
GO:0044248 cellular catabolic process No
GO:0090304 nucleic acid metabolic process No
GO:1901361 organic cyclic compound catabolic process No
GO:1901575 organic substance catabolic process No
GO:0140535 intracellular protein-containing complex No
GO:0008150 biological_process No
GO:0044270 cellular nitrogen compound catabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0019439 aromatic compound catabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2344 0.9077 0.2666 0.0114 0.046 0.0041 0.0632 0.0141 0.0062 0.0108

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 72.74 34.26 111.22
Alive In ants, during behavior modification 228.06 127.42 328.70
Dead In ants, recently dead 110.42 56.07 164.76

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.000238 yes
Dead Fungus 0.061632 no

Orthologs

Orthofinder run ID4
Orthogroup5718
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7126
Ophiocordyceps australis map64 (Brazil) OphauB2|1137
Ophiocordyceps camponoti-floridani Ophcf2|05602 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7319
Ophiocordyceps kimflemingae Ophio5|6444
Ophiocordyceps subramaniannii Hirsu2|8965

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05602
MSTSSESMLAIAGESDKRKAVPNLLPCRIRHTGPIDSVAGYWAPSSPKQDEPRVAYFRGRKLHGRAVAVPDRYEG
VVVRREAGDRKRKHSQLCGEDEDDGAVAAEPETETLRVTARFDEVLVWAHEATMDSTDEYVRGVEEWLQVADKIH
SFGERDETSG*
Coding >Ophcf2|05602
ATGTCGACATCGAGCGAGTCGATGCTCGCCATCGCCGGCGAGAGCGACAAGCGCAAGGCGGTGCCGAACCTGCTG
CCGTGTCGCATCCGTCACACAGGACCAATCGATTCAGTCGCTGGGTATTGGGCTCCTAGTAGCCCGAAGCAAGAT
GAACCTCGAGTCGCCTACTTCCGGGGACGGAAGCTGCACGGTCGGGCTGTCGCCGTTCCGGACCGTTACGAGGGC
GTCGTGGTGCGGCGGGAGGCTGGGGATAGGAAGAGGAAGCATTCGCAACTGTGCGGAGAAGACGAGGATGACGGA
GCCGTCGCAGCGGAACCGGAGACGGAGACTCTGCGGGTTACGGCTCGCTTTGACGAGGTGCTGGTGTGGGCTCAC
GAGGCGACGATGGACTCGACGGATGAGTACGTGCGTGGTGTGGAGGAGTGGTTGCAGGTTGCAGACAAGATACAT
TCGTTTGGGGAGCGGGACGAGACAAGCGGGTGA
Transcript >Ophcf2|05602
ATGTCGACATCGAGCGAGTCGATGCTCGCCATCGCCGGCGAGAGCGACAAGCGCAAGGCGGTGCCGAACCTGCTG
CCGTGTCGCATCCGTCACACAGGACCAATCGATTCAGTCGCTGGGTATTGGGCTCCTAGTAGCCCGAAGCAAGAT
GAACCTCGAGTCGCCTACTTCCGGGGACGGAAGCTGCACGGTCGGGCTGTCGCCGTTCCGGACCGTTACGAGGGC
GTCGTGGTGCGGCGGGAGGCTGGGGATAGGAAGAGGAAGCATTCGCAACTGTGCGGAGAAGACGAGGATGACGGA
GCCGTCGCAGCGGAACCGGAGACGGAGACTCTGCGGGTTACGGCTCGCTTTGACGAGGTGCTGGTGTGGGCTCAC
GAGGCGACGATGGACTCGACGGATGAGTACGTGCGTGGTGTGGAGGAGTGGTTGCAGGTTGCAGACAAGATACAT
TCGTTTGGGGAGCGGGACGAGACAAGCGGGTGA
Gene >Ophcf2|05602
ATGTCGACATCGAGCGAGTCGATGCTCGCCATCGCCGGCGAGAGCGACAAGCGCAAGGCGGTGCCGAACCTGCTG
CCGTGTCGCATCCGTCACACAGGACCAATCGATTCAGTCGCTGGGTATTGGGCTCCTAGTAGCCCGAAGCAAGGC
AGGGACCACGATAGTTTCACAATGCAGCAAGCTTTCTCTGACCTTGTCTACCCCGCAGATGAACCTCGAGTCGCC
TACTTCCGGGGACGGAAGCTGCACGGTCGGGCTGTCGCCGTTCCGGACCGTTACGAGGGCGTCGTGGTGCGGCGG
GAGGCTGGGGATAGGAAGAGGAAGCATTCGCAACTGTGCGGAGAAGACGAGGATGACGGAGCCGTCGCAGCGGAA
CCGGAGACGGAGACTCTGCGGGTTACGGCTCGCTTTGACGAGGTGCTGGTGTGGGCTCACGAGGCGACGATGGAC
TCGACGGATGAGTACGTGCGTGGTGTGGAGGAGTGGTTGCAGGTTGCAGACAAGGTGTGTTTTTCTCTGCTTCTC
AATAACGCTTCTCATGAATGTTATAAGATAGCTGACAAGACCGGGTAGATACATTCGTTTGGGGAGCGGGACGAG
ACAAGCGGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail