Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05601
Gene name
Locationscaffold_06:654362..657261
Strand-
Gene length (bp)2899
Transcript length (bp)2772
Coding sequence length (bp)2772
Protein length (aa) 924

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00493 MCM MCM P-loop domain 3.8E-102 428 649
PF17207 MCM_OB MCM OB domain 5.2E-38 199 327
PF18263 MCM6_C MCM6 C-terminal winged-helix domain 9.0E-29 814 920
PF17855 MCM_lid MCM AAA-lid domain 5.1E-23 663 750
PF14551 MCM_N MCM N-terminal domain 7.9E-22 65 192
PF01078 Mg_chelatase Magnesium chelatase, subunit ChlI 2.1E-06 533 629

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0032508 DNA duplex unwinding Yes
GO:0003677 DNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0071103 DNA conformation change No
GO:0009987 cellular process No
GO:0003676 nucleic acid binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0071840 cellular component organization or biogenesis No
GO:0005488 binding No
GO:0032559 adenyl ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0006996 organelle organization No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0051276 chromosome organization No
GO:0000166 nucleotide binding No
GO:0016043 cellular component organization No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0008150 biological_process No
GO:0030554 adenyl nucleotide binding No
GO:0032392 DNA geometric change No
GO:0097367 carbohydrate derivative binding No
GO:0035639 purine ribonucleoside triphosphate binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear export signal 0.3736 0.7661 0.0612 0.0221 0.1859 0.0033 0.1404 0.0796 0.0333 0.0155

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5719
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7125
Ophiocordyceps australis map64 (Brazil) OphauB2|5494
Ophiocordyceps camponoti-floridani Ophcf2|05601 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7320
Ophiocordyceps kimflemingae Ophio5|3195
Ophiocordyceps subramaniannii Hirsu2|8966

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05601
MSDAPSQAARPSRNLGPPSSAQMSEGLGALSEDGFADDQVPERARTTDTADVPRVEDRVGLLVKDYFQDFIENFV
EDHSSSGAPASSAVSGDKYYVARIRGMRNYQLSTLYVDFKHILSHNDGLANGIVQDYYRMLPFLTAALNNMIMQY
EPQYFKEHRQPTASGSQSASQGSLRKNEHQQTDKLFAIAIFNLPLVSRVRSLRAANIGQLLSISGTVTRTSEVRP
ELSLATFVCEDCRAIVPNVEQTFRYTEPTQCPNGICANRVNWQLDIRHSTFVDWQKVRIQENSSEIPTGSMPRTL
DVILRGEMVDRAKAGEKCIFTGALIVVPDVSQLGLPGVRATAVRDERGLPRGDDAGGSGVSGLKALGVRDLTYRL
AFLACMVVADTTSKAGGGATAEVINALAQRSEAETSEEMQNAILTSMSEAELAQLRDMVNGDDIYARLVRSMAPM
VYGHEVVKKGILLQLLSGVHKTTAEGMQLRGDINICIVGDPSTSKSQFLKYVCSFAPRAVYTSGKASSAAGLTAA
VVKDEETGDFTIEAGALMLADNGICAIDEFDKMDIVDQVAIHEAMEQQTISIAKAGIHATLNARTSILAAANPVG
GRYNRKTTLRSNINMSAPIMSRFDLFFVILDECSEQVDRHLASHIVAIHQHRDAAVEPEFSTEQLQRFIRFARTF
QPTFTEAAKELLVEKYKQLRADDAQGGVGRNSYRITVRQLESMIRLSEAIARAWCTDKIEPSMVDEAYNLLRQSI
ISVEYDDVEVDDDENTTNNNNNNNDDDDDDDDDQDSPPQGPHLHRAATAAPGQPPSTPNPRPKKKHTMTHEKYTS
MVNAFVQRISDDESSSGDGLSQDTLLEWYLEQREDELASEESYHQERALAVLVLKKMVKDNILMALRGEGLVDEE
GGSSSASSAVVYVLHPNCAVEEF*
Coding >Ophcf2|05601
ATGTCGGACGCCCCCTCGCAGGCCGCCCGACCAAGCCGCAACCTCGGACCCCCCTCGTCGGCGCAAATGTCGGAA
GGCCTCGGCGCTCTCAGCGAGGATGGTTTCGCCGACGATCAGGTGCCGGAGAGAGCGCGCACGACTGACACCGCC
GATGTCCCGCGAGTCGAGGACAGGGTTGGGCTGCTCGTCAAGGATTACTTCCAAGACTTCATCGAGAACTTCGTC
GAGGACCATTCATCTTCAGGCGCACCGGCTTCGAGTGCCGTCTCGGGCGATAAATACTACGTGGCGCGCATCCGG
GGCATGCGCAACTATCAGCTGTCGACGCTCTACGTCGACTTCAAGCACATCCTCTCACACAACGACGGCTTGGCC
AACGGTATCGTACAGGATTACTACCGCATGCTGCCCTTTCTCACTGCCGCTCTCAACAACATGATAATGCAGTAC
GAGCCTCAGTACTTCAAGGAACACCGCCAGCCAACGGCTTCCGGCAGTCAATCCGCCAGCCAGGGATCACTCCGC
AAGAACGAGCACCAGCAGACGGACAAGCTCTTCGCAATCGCCATCTTCAATCTACCGCTCGTCTCGCGCGTGCGC
AGCCTCCGGGCGGCCAACATCGGCCAGCTGCTATCCATCTCGGGCACGGTGACACGAACGTCAGAAGTACGGCCT
GAGCTCTCGCTGGCGACGTTCGTATGCGAAGACTGTCGAGCCATCGTTCCCAACGTTGAGCAGACGTTCCGGTAC
ACAGAGCCGACGCAATGTCCCAACGGCATTTGCGCCAACCGCGTCAACTGGCAGCTCGACATCCGGCACAGCACC
TTTGTCGACTGGCAAAAGGTGCGCATCCAGGAGAACAGCTCGGAGATCCCAACGGGCAGCATGCCGCGCACGCTC
GACGTCATCCTACGCGGCGAGATGGTAGACCGAGCCAAAGCCGGCGAAAAGTGCATCTTCACCGGCGCCCTCATC
GTCGTACCGGACGTCAGCCAGCTCGGCCTACCAGGCGTAAGGGCAACAGCCGTCCGGGACGAACGCGGTCTCCCT
CGCGGCGATGACGCCGGTGGCAGCGGCGTCAGCGGGCTCAAGGCTCTCGGCGTACGCGATCTCACCTATCGACTG
GCCTTCTTAGCCTGCATGGTGGTGGCAGATACGACATCCAAGGCAGGCGGAGGCGCGACAGCCGAGGTGATCAAC
GCGCTGGCTCAGAGAAGCGAGGCCGAGACGAGCGAGGAGATGCAGAACGCCATCCTGACGTCTATGAGCGAGGCT
GAACTGGCGCAGTTGCGTGACATGGTCAACGGCGACGACATATACGCCCGGCTGGTACGATCCATGGCGCCCATG
GTCTACGGTCACGAGGTAGTCAAGAAGGGCATCCTTCTACAGCTACTATCGGGCGTGCACAAGACGACAGCAGAG
GGAATGCAACTCCGAGGCGACATCAACATCTGCATCGTCGGCGATCCATCGACTTCCAAATCGCAATTCCTCAAA
TACGTATGCTCCTTCGCGCCCCGAGCCGTCTACACCTCTGGCAAAGCCTCTTCAGCAGCAGGCCTCACAGCAGCC
GTCGTCAAGGACGAAGAAACAGGCGACTTCACCATCGAAGCCGGCGCCCTGATGCTGGCCGACAACGGCATCTGC
GCCATCGACGAGTTCGACAAGATGGACATCGTCGACCAGGTAGCCATCCACGAAGCAATGGAACAACAAACAATC
TCCATCGCCAAAGCCGGCATCCACGCAACCCTCAACGCCCGAACCAGCATCCTAGCAGCCGCCAACCCCGTCGGA
GGTCGCTACAACCGCAAGACCACCCTCCGAAGCAACATCAACATGTCAGCCCCCATCATGTCCCGCTTCGACCTC
TTCTTCGTCATCCTAGACGAATGCTCCGAGCAGGTAGACCGCCATCTAGCCTCCCACATCGTCGCCATCCACCAA
CACCGCGACGCAGCCGTCGAACCCGAGTTCAGCACGGAGCAACTCCAGCGCTTCATCCGTTTCGCCCGCACCTTC
CAACCGACCTTTACCGAAGCGGCCAAAGAGCTCCTCGTCGAGAAATACAAGCAGTTGAGAGCCGACGATGCGCAG
GGAGGCGTCGGTAGGAATTCCTATCGCATTACCGTCAGGCAGCTCGAGAGCATGATTAGGCTCAGCGAGGCCATT
GCCCGTGCCTGGTGCACTGATAAGATTGAGCCTTCCATGGTGGATGAAGCCTACAATTTGCTCAGACAGAGCATC
ATCTCGGTCGAATACGACGACGTCGAAGTCGATGACGACGAAAACACCACCAACAACAACAACAACAACAACGAC
GACGACGACGACGACGACGATGATCAAGACTCACCCCCCCAAGGCCCTCACCTCCACCGCGCCGCCACCGCCGCC
CCAGGCCAACCACCCTCAACACCAAACCCCCGCCCCAAGAAGAAACACACAATGACGCACGAGAAATACACGTCA
ATGGTAAACGCCTTCGTCCAACGCATCAGCGACGACGAATCCTCCTCCGGGGACGGCCTCTCGCAAGATACCCTG
CTGGAATGGTACCTCGAGCAGCGAGAAGACGAACTCGCCAGCGAAGAGAGCTATCATCAAGAGCGGGCGCTGGCG
GTGCTGGTTCTGAAGAAGATGGTCAAGGATAATATTCTGATGGCGTTGAGAGGAGAGGGCCTCGTTGATGAGGAA
GGGGGCTCTTCATCTGCTTCTTCGGCCGTTGTTTACGTCCTTCACCCCAACTGTGCCGTCGAAGAGTTTTAA
Transcript >Ophcf2|05601
ATGTCGGACGCCCCCTCGCAGGCCGCCCGACCAAGCCGCAACCTCGGACCCCCCTCGTCGGCGCAAATGTCGGAA
GGCCTCGGCGCTCTCAGCGAGGATGGTTTCGCCGACGATCAGGTGCCGGAGAGAGCGCGCACGACTGACACCGCC
GATGTCCCGCGAGTCGAGGACAGGGTTGGGCTGCTCGTCAAGGATTACTTCCAAGACTTCATCGAGAACTTCGTC
GAGGACCATTCATCTTCAGGCGCACCGGCTTCGAGTGCCGTCTCGGGCGATAAATACTACGTGGCGCGCATCCGG
GGCATGCGCAACTATCAGCTGTCGACGCTCTACGTCGACTTCAAGCACATCCTCTCACACAACGACGGCTTGGCC
AACGGTATCGTACAGGATTACTACCGCATGCTGCCCTTTCTCACTGCCGCTCTCAACAACATGATAATGCAGTAC
GAGCCTCAGTACTTCAAGGAACACCGCCAGCCAACGGCTTCCGGCAGTCAATCCGCCAGCCAGGGATCACTCCGC
AAGAACGAGCACCAGCAGACGGACAAGCTCTTCGCAATCGCCATCTTCAATCTACCGCTCGTCTCGCGCGTGCGC
AGCCTCCGGGCGGCCAACATCGGCCAGCTGCTATCCATCTCGGGCACGGTGACACGAACGTCAGAAGTACGGCCT
GAGCTCTCGCTGGCGACGTTCGTATGCGAAGACTGTCGAGCCATCGTTCCCAACGTTGAGCAGACGTTCCGGTAC
ACAGAGCCGACGCAATGTCCCAACGGCATTTGCGCCAACCGCGTCAACTGGCAGCTCGACATCCGGCACAGCACC
TTTGTCGACTGGCAAAAGGTGCGCATCCAGGAGAACAGCTCGGAGATCCCAACGGGCAGCATGCCGCGCACGCTC
GACGTCATCCTACGCGGCGAGATGGTAGACCGAGCCAAAGCCGGCGAAAAGTGCATCTTCACCGGCGCCCTCATC
GTCGTACCGGACGTCAGCCAGCTCGGCCTACCAGGCGTAAGGGCAACAGCCGTCCGGGACGAACGCGGTCTCCCT
CGCGGCGATGACGCCGGTGGCAGCGGCGTCAGCGGGCTCAAGGCTCTCGGCGTACGCGATCTCACCTATCGACTG
GCCTTCTTAGCCTGCATGGTGGTGGCAGATACGACATCCAAGGCAGGCGGAGGCGCGACAGCCGAGGTGATCAAC
GCGCTGGCTCAGAGAAGCGAGGCCGAGACGAGCGAGGAGATGCAGAACGCCATCCTGACGTCTATGAGCGAGGCT
GAACTGGCGCAGTTGCGTGACATGGTCAACGGCGACGACATATACGCCCGGCTGGTACGATCCATGGCGCCCATG
GTCTACGGTCACGAGGTAGTCAAGAAGGGCATCCTTCTACAGCTACTATCGGGCGTGCACAAGACGACAGCAGAG
GGAATGCAACTCCGAGGCGACATCAACATCTGCATCGTCGGCGATCCATCGACTTCCAAATCGCAATTCCTCAAA
TACGTATGCTCCTTCGCGCCCCGAGCCGTCTACACCTCTGGCAAAGCCTCTTCAGCAGCAGGCCTCACAGCAGCC
GTCGTCAAGGACGAAGAAACAGGCGACTTCACCATCGAAGCCGGCGCCCTGATGCTGGCCGACAACGGCATCTGC
GCCATCGACGAGTTCGACAAGATGGACATCGTCGACCAGGTAGCCATCCACGAAGCAATGGAACAACAAACAATC
TCCATCGCCAAAGCCGGCATCCACGCAACCCTCAACGCCCGAACCAGCATCCTAGCAGCCGCCAACCCCGTCGGA
GGTCGCTACAACCGCAAGACCACCCTCCGAAGCAACATCAACATGTCAGCCCCCATCATGTCCCGCTTCGACCTC
TTCTTCGTCATCCTAGACGAATGCTCCGAGCAGGTAGACCGCCATCTAGCCTCCCACATCGTCGCCATCCACCAA
CACCGCGACGCAGCCGTCGAACCCGAGTTCAGCACGGAGCAACTCCAGCGCTTCATCCGTTTCGCCCGCACCTTC
CAACCGACCTTTACCGAAGCGGCCAAAGAGCTCCTCGTCGAGAAATACAAGCAGTTGAGAGCCGACGATGCGCAG
GGAGGCGTCGGTAGGAATTCCTATCGCATTACCGTCAGGCAGCTCGAGAGCATGATTAGGCTCAGCGAGGCCATT
GCCCGTGCCTGGTGCACTGATAAGATTGAGCCTTCCATGGTGGATGAAGCCTACAATTTGCTCAGACAGAGCATC
ATCTCGGTCGAATACGACGACGTCGAAGTCGATGACGACGAAAACACCACCAACAACAACAACAACAACAACGAC
GACGACGACGACGACGACGATGATCAAGACTCACCCCCCCAAGGCCCTCACCTCCACCGCGCCGCCACCGCCGCC
CCAGGCCAACCACCCTCAACACCAAACCCCCGCCCCAAGAAGAAACACACAATGACGCACGAGAAATACACGTCA
ATGGTAAACGCCTTCGTCCAACGCATCAGCGACGACGAATCCTCCTCCGGGGACGGCCTCTCGCAAGATACCCTG
CTGGAATGGTACCTCGAGCAGCGAGAAGACGAACTCGCCAGCGAAGAGAGCTATCATCAAGAGCGGGCGCTGGCG
GTGCTGGTTCTGAAGAAGATGGTCAAGGATAATATTCTGATGGCGTTGAGAGGAGAGGGCCTCGTTGATGAGGAA
GGGGGCTCTTCATCTGCTTCTTCGGCCGTTGTTTACGTCCTTCACCCCAACTGTGCCGTCGAAGAGTTTTAA
Gene >Ophcf2|05601
ATGTCGGACGCCCCCTCGCAGGCCGCCCGACCAAGCCGCAACCTCGGACCCCCCTCGTCGGCGCAAATGTCGGAA
GGCCTCGGCGCTCTCAGCGAGGATGGTTTCGCCGACGATCAGGTGCCGGAGAGAGCGCGCACGACTGACACCGCC
GATGTCCCGCGAGTCGAGGACAGGGTTGGGCTGCTCGTCAAGGATTACTTCCAAGACTTCATCGAGAAGTGAGTA
GGCAAAGATTGGAGTCGGATGGAAGGTCTGCTGACGGATATAGCTTCGTCGAGGACCATTCATCTTCAGGCGCAC
CGGCTTCGAGTGCCGTCTCGGGCGATAAATACTACGTGGCGCGCATCCGGGGCATGCGCAACTATCAGCTGTCGA
CGCTCTACGTCGACTTCAAGCACATCCTCTCACACAACGACGGCTTGGCCAACGGTATCGTACAGGATTACTACC
GCATGCTGCCCTTTCTCACTGCCGCTCTCAACAACATGATAATGCAGTACGAGCCTCAGTACTTCAAGGAACACC
GCCAGCCAACGGCTTCCGGCAGTCAATCCGCCAGCCAGGGATCACTCCGCAAGAACGAGCACCAGCAGACGGACA
AGCTCTTCGCAATCGCCATCTTCAATCTACCGCTCGTCTCGCGCGTGCGCAGCCTCCGGGCGGCCAACATCGGCC
AGCTGCTATCCATCTCGGGCACGGTGACACGAACGTCAGAAGTACGGCCTGAGCTCTCGCTGGCGACGTTCGTAT
GCGAAGACTGTCGAGCCATCGTTCCCAACGTTGAGCAGACGTTCCGGTACACAGAGCCGACGCAATGTCCCAACG
GCATTTGCGCCAACCGCGTCAACTGGCAGCTCGACATCCGGCACAGCACCTTTGTCGACTGGCAAAAGGTGCGCA
TCCAGGAGAACAGCTCGGAGATCCCAACGGGCAGCATGCCGCGCACGCTCGACGTCATCCTACGCGGCGAGATGG
TAGACCGAGCCAAAGCCGGCGAAAAGTGCATCTTCACCGGCGCCCTCATCGTCGTACCGGACGTCAGCCAGCTCG
GCCTACCAGGCGTAAGGGCAACAGCCGTCCGGGACGAACGCGGTCTCCCTCGCGGCGATGACGCCGGTGGCAGCG
GCGTCAGCGGGCTCAAGGCTCTCGGCGTACGCGATCTCACCTATCGACTGGCCTTCTTAGCCTGCATGGTGGTGG
CAGATACGACATCCAAGGCAGGCGGAGGCGCGACAGCCGAGGTGATCAACGCGCTGGCTCAGAGAAGCGAGGCCG
AGACGAGCGAGGAGATGCAGAACGCCATCCTGACGTCTATGAGCGAGGCTGAACTGGCGCAGTTGCGTGACATGG
TCAACGGCGACGACATATACGCCCGGCTGGTACGATCCATGGCGCCCATGGTCTACGGTCACGAGGTAGTCAAGA
AGGGCATCCTTCTACAGCTACTATCGGGCGTGCACAAGACGACAGCAGAGGGAATGCAACTCCGAGGCGACATCA
ACATCTGCATCGTCGGCGATCCATCGACTTCCAAATCGCAATTCCTCAAATACGTATGCTCCTTCGCGCCCCGAG
CCGTCTACACCTCTGGCAAAGCCTCTTCAGCAGCAGGCCTCACAGCAGCCGTCGTCAAGGACGAAGAAACAGGCG
ACTTCACCATCGAAGCCGGCGCCCTGATGCTGGCCGACAACGGCATCTGCGCCATCGACGAGTTCGACAAGATGG
ACATCGTCGACCAGGTAGCCATCCACGAAGCAATGGAACAACAAACAATCTCCATCGCCAAAGCCGGCATCCACG
CAACCCTCAACGCCCGAACCAGCATCCTAGCAGCCGCCAACCCCGTCGGAGGTCGCTACAACCGCAAGACCACCC
TCCGAAGCAACATCAACATGTCAGCCCCCATCATGTCCCGCTTCGACCTCTTCTTCGTCATCCTAGACGAATGCT
CCGAGCAGGTAGACCGCCATCTAGCCTCCCACATCGTCGCCATCCACCAACACCGCGACGCAGCCGTCGAACCCG
AGTTCAGCACGGAGCAACTCCAGCGCTTCATCCGTTTCGCCCGCACCTTCCAACCGACCTTTACCGAAGCGGCCA
AAGAGCTCCTCGTCGAGAAATACAAGCAGTTGAGAGCCGACGATGCGCAGGGAGGCGTCGGTAGGAATTCCTATC
GCATTACCGTCAGGCAGCTCGAGAGCATGATTAGGCTCAGCGAGGCCATTGCCCGTGCCTGGTGCACTGATAAGA
TTGAGCCTTCCATGGTGGATGAAGCCTACAATTTGCTCAGACAGAGCATCATCTCGGTCGAATACGACGACGTCG
AAGTCGATGACGACGAAAACACCACCAACAACAACAACAACAACAACGACGACGACGACGACGACGACGATGATC
AAGACTCACCCCCCCAAGGCCCTCACCTCCACCGCGCCGCCACCGCCGCCCCAGGCCAACCACCCTCAACACCAA
ACCCCCGCCCCAAGAAGAAACACACAATGACGCACGAGAAATACACGTCAATGGTAAACGCCTTCGTCCAACGCA
TCAGCGACGACGAATCCTCCTCCGGGGACGGCCTCTCGCAAGATACCCTGCTGGAATGGTACCTCGAGCAGCGAG
AAGACGAACTCGCCAGCGAAGAGAGCTATCATCAAGAGCGGGCGCTGGCGGTGCTGGTTCTGAAGAAGATGGTCA
AGGTGAGCACCCCCCCTCTTTCTTAATTGTATATATATATACTCTCTGTTCGGGAGCTGATGCATGGTGGTTTGA
TTAGGATAATATTCTGATGGCGTTGAGAGGAGAGGGCCTCGTTGATGAGGAAGGGGGCTCTTCATCTGCTTCTTC
GGCCGTTGTTTACGTCCTTCACCCCAACTGTGCCGTCGAAGAGTTTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail