Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05595
Gene name
Locationscaffold_06:640214..642333
Strand-
Gene length (bp)2119
Transcript length (bp)2046
Coding sequence length (bp)2046
Protein length (aa) 682

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 7.9E-41 157 475
PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 6.5E-09 318 398

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 82 104 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05595
MRAPVPLPVGGGRVAAARILAGGTQSRLIYPIRACSALQQSRATLPFPTALLIHRRLGGIRGISGKPLPQARSWI
HNFIYRAAAWVGISIAVVGSCIVAFFIYDATTYKEGADLGDIDVSQLALQPRRGGPKNLPIAEVLVDDDDSESKK
STKHKPRLVVLGGGWGGVALLKELDPDDYHVTVISPRNYFLFTPMLPSATVGTLELRSLIEPIRRIIGRVHGHFL
CAKAEDVVFTDRLVEVSQLDSNGKESRFYVPYDKLVIAVGSVTNPHGVKGLDNAFFLKDLEDSRRIRSRVVRNLE
LACLPTTTDDERKRLLSFVICGGGPTGVEVAAELFDLLNEDLTRMFPRLLRNEISVHLIQSRSHILNTYDEAVSH
YAEKRFARDQVEVLTNSRVKEVLPDKIIFSQKQADGSIVTKELPAGFCLWSTGLAQTHLCQKLARRLGDFQPNRH
ALETDTHLRVKGTPLGDVYAIGDCSTVQNNVADHVINFLRAYAWKRGKDPETIQLSFSDWQHVARDVKKRFPQSV
NHLRRLDKLFSEFDKDESGTLDLGELRELLGQIDSKLTSLPATAQRAHQQGSYLAVKLHRLARMSDGLSANDIRD
GDVDAAAYRAFEYRHLGSLAYLGNAAVFDLGRGGWSVAGGLWAVYAWRSVYFAQSVSFRTRSLMAMDWAKRALFG
RDFASL*
Coding >Ophcf2|05595
ATGCGGGCGCCTGTGCCTCTGCCTGTAGGAGGAGGAAGAGTAGCAGCAGCTCGCATCTTGGCCGGCGGTACTCAA
TCTCGACTGATTTATCCGATCCGAGCATGCAGTGCCCTCCAGCAATCCCGGGCCACGCTGCCGTTCCCTACAGCG
CTACTCATTCACAGAAGACTCGGCGGCATCCGCGGGATATCCGGAAAGCCTCTCCCGCAGGCCCGGTCGTGGATT
CACAACTTCATCTACCGGGCCGCCGCGTGGGTGGGCATATCGATAGCCGTCGTGGGCAGCTGCATCGTCGCCTTC
TTCATCTACGACGCAACGACATACAAGGAGGGCGCTGATCTGGGCGACATCGACGTCTCGCAGCTGGCGCTACAA
CCTCGTCGGGGAGGGCCCAAGAACTTGCCCATCGCTGAGGTGCTTGTCGACGATGACGATAGCGAGAGCAAGAAG
AGCACCAAGCACAAGCCCAGGCTGGTCGTTCTCGGCGGCGGCTGGGGTGGTGTGGCGCTGCTCAAGGAGTTGGAT
CCGGATGATTATCATGTGACGGTGATATCACCGAGAAACTACTTTCTCTTTACGCCTATGCTTCCATCAGCGACG
GTCGGCACTCTTGAGCTGCGGTCTCTTATAGAGCCGATCCGTCGCATTATCGGCCGAGTTCATGGACACTTCCTC
TGTGCCAAGGCCGAGGATGTCGTCTTTACCGATAGACTCGTTGAGGTCTCGCAGCTGGATTCCAACGGAAAAGAG
AGTCGGTTCTACGTGCCGTACGACAAGCTCGTCATTGCTGTCGGGTCCGTCACCAACCCTCACGGCGTCAAGGGT
CTCGACAATGCCTTCTTCCTCAAGGATCTGGAAGACTCGCGCAGGATTCGAAGCCGTGTCGTTCGCAACCTCGAG
CTCGCCTGTTTGCCGACGACGACTGATGACGAGCGCAAACGTCTGCTTTCCTTTGTCATTTGCGGTGGTGGCCCT
ACGGGAGTCGAGGTGGCGGCTGAGTTGTTTGATCTACTCAACGAAGATCTAACGCGCATGTTTCCCCGACTACTG
AGGAACGAGATTTCAGTCCATCTTATCCAGAGCCGGAGTCACATCCTCAACACGTACGACGAGGCCGTCTCGCAC
TACGCCGAGAAGCGATTCGCCCGCGACCAGGTCGAGGTGCTCACCAACTCCAGGGTAAAGGAGGTGCTACCAGAC
AAGATCATCTTCTCCCAGAAGCAGGCGGACGGCTCCATCGTGACCAAGGAGCTACCAGCCGGCTTCTGTCTCTGG
TCGACGGGCCTCGCGCAGACGCATCTTTGTCAGAAACTGGCACGACGATTGGGTGACTTCCAGCCAAACCGACAC
GCGCTCGAGACGGACACGCACCTGCGCGTCAAGGGAACGCCTCTGGGCGACGTCTACGCCATTGGCGATTGCTCA
ACGGTACAGAACAACGTGGCCGACCACGTCATCAACTTCCTCCGCGCCTACGCCTGGAAACGCGGCAAGGACCCA
GAAACGATCCAACTCAGCTTCAGCGACTGGCAGCACGTAGCACGCGACGTGAAGAAGCGCTTCCCCCAATCAGTA
AACCACCTCCGCCGCCTCGACAAGCTCTTCTCCGAATTCGATAAAGACGAGTCCGGTACCCTCGACCTAGGCGAA
CTCCGCGAACTCCTCGGCCAAATCGACAGCAAGCTAACCTCCCTGCCCGCCACCGCCCAACGCGCCCACCAGCAG
GGCTCCTACCTGGCCGTCAAGCTGCACCGCCTAGCCCGCATGTCAGACGGGCTCAGCGCAAACGACATCCGCGAC
GGCGACGTCGACGCCGCTGCCTACCGTGCCTTTGAGTATCGTCATCTCGGAAGCTTGGCTTACCTCGGCAACGCG
GCCGTCTTTGATCTCGGGCGTGGCGGGTGGAGTGTTGCGGGGGGGCTTTGGGCTGTGTACGCCTGGCGATCTGTT
TATTTTGCGCAGAGTGTTAGCTTTAGGACGAGGTCGCTCATGGCTATGGATTGGGCGAAGAGGGCTTTGTTCGGA
AGAGACTTTGCGAGTCTCTGA
Transcript >Ophcf2|05595
ATGCGGGCGCCTGTGCCTCTGCCTGTAGGAGGAGGAAGAGTAGCAGCAGCTCGCATCTTGGCCGGCGGTACTCAA
TCTCGACTGATTTATCCGATCCGAGCATGCAGTGCCCTCCAGCAATCCCGGGCCACGCTGCCGTTCCCTACAGCG
CTACTCATTCACAGAAGACTCGGCGGCATCCGCGGGATATCCGGAAAGCCTCTCCCGCAGGCCCGGTCGTGGATT
CACAACTTCATCTACCGGGCCGCCGCGTGGGTGGGCATATCGATAGCCGTCGTGGGCAGCTGCATCGTCGCCTTC
TTCATCTACGACGCAACGACATACAAGGAGGGCGCTGATCTGGGCGACATCGACGTCTCGCAGCTGGCGCTACAA
CCTCGTCGGGGAGGGCCCAAGAACTTGCCCATCGCTGAGGTGCTTGTCGACGATGACGATAGCGAGAGCAAGAAG
AGCACCAAGCACAAGCCCAGGCTGGTCGTTCTCGGCGGCGGCTGGGGTGGTGTGGCGCTGCTCAAGGAGTTGGAT
CCGGATGATTATCATGTGACGGTGATATCACCGAGAAACTACTTTCTCTTTACGCCTATGCTTCCATCAGCGACG
GTCGGCACTCTTGAGCTGCGGTCTCTTATAGAGCCGATCCGTCGCATTATCGGCCGAGTTCATGGACACTTCCTC
TGTGCCAAGGCCGAGGATGTCGTCTTTACCGATAGACTCGTTGAGGTCTCGCAGCTGGATTCCAACGGAAAAGAG
AGTCGGTTCTACGTGCCGTACGACAAGCTCGTCATTGCTGTCGGGTCCGTCACCAACCCTCACGGCGTCAAGGGT
CTCGACAATGCCTTCTTCCTCAAGGATCTGGAAGACTCGCGCAGGATTCGAAGCCGTGTCGTTCGCAACCTCGAG
CTCGCCTGTTTGCCGACGACGACTGATGACGAGCGCAAACGTCTGCTTTCCTTTGTCATTTGCGGTGGTGGCCCT
ACGGGAGTCGAGGTGGCGGCTGAGTTGTTTGATCTACTCAACGAAGATCTAACGCGCATGTTTCCCCGACTACTG
AGGAACGAGATTTCAGTCCATCTTATCCAGAGCCGGAGTCACATCCTCAACACGTACGACGAGGCCGTCTCGCAC
TACGCCGAGAAGCGATTCGCCCGCGACCAGGTCGAGGTGCTCACCAACTCCAGGGTAAAGGAGGTGCTACCAGAC
AAGATCATCTTCTCCCAGAAGCAGGCGGACGGCTCCATCGTGACCAAGGAGCTACCAGCCGGCTTCTGTCTCTGG
TCGACGGGCCTCGCGCAGACGCATCTTTGTCAGAAACTGGCACGACGATTGGGTGACTTCCAGCCAAACCGACAC
GCGCTCGAGACGGACACGCACCTGCGCGTCAAGGGAACGCCTCTGGGCGACGTCTACGCCATTGGCGATTGCTCA
ACGGTACAGAACAACGTGGCCGACCACGTCATCAACTTCCTCCGCGCCTACGCCTGGAAACGCGGCAAGGACCCA
GAAACGATCCAACTCAGCTTCAGCGACTGGCAGCACGTAGCACGCGACGTGAAGAAGCGCTTCCCCCAATCAGTA
AACCACCTCCGCCGCCTCGACAAGCTCTTCTCCGAATTCGATAAAGACGAGTCCGGTACCCTCGACCTAGGCGAA
CTCCGCGAACTCCTCGGCCAAATCGACAGCAAGCTAACCTCCCTGCCCGCCACCGCCCAACGCGCCCACCAGCAG
GGCTCCTACCTGGCCGTCAAGCTGCACCGCCTAGCCCGCATGTCAGACGGGCTCAGCGCAAACGACATCCGCGAC
GGCGACGTCGACGCCGCTGCCTACCGTGCCTTTGAGTATCGTCATCTCGGAAGCTTGGCTTACCTCGGCAACGCG
GCCGTCTTTGATCTCGGGCGTGGCGGGTGGAGTGTTGCGGGGGGGCTTTGGGCTGTGTACGCCTGGCGATCTGTT
TATTTTGCGCAGAGTGTTAGCTTTAGGACGAGGTCGCTCATGGCTATGGATTGGGCGAAGAGGGCTTTGTTCGGA
AGAGACTTTGCGAGTCTCTGA
Gene >Ophcf2|05595
ATGCGGGCGCCTGTGCCTCTGCCTGTAGGAGGAGGAAGAGTAGCAGCAGCTCGCATCTTGGCCGGCGGTACTCAA
TCTCGACTGATTTATCCGATCCGAGCATGCAGTGCCCTCCAGCAATCCCGGGCCACGCTGCCGTTCCCTACAGCG
CTACTCATTCACAGAAGACTCGGCGGCATCCGCGGGATATCCGGAAAGCCTCTCCCGCAGGCCCGGTCGTGGATT
CACAACTTCATCTACCGGGCCGCCGCGTGGGTGGGCATATCGATAGCCGTCGTGGGCAGCTGCATCGTCGCCTTC
TTCATCTACGACGCAACGACATACAAGGAGGGCGCTGATCTGGGCGACATCGACGTCTCGCAGCTGGCGCTACAA
CCTCGTCGGGGAGGGCCCAAGAACTTGCCCATCGCTGAGGTGCTTGTCGACGATGACGATAGCGAGAGCAAGAAG
AGCACCAAGCACAAGCCCAGGCTGGTCGTTCTCGGCGGCGGCTGGGGTGGTGTGGCGCTGCTCAAGGAGTTGGAT
CCGGATGATTATCATGTGACGGTGATATCACCGAGAAACTACTTTCTCTTTACGCCTATGCTTCCATCAGCGACG
GTCGGCACTCTTGAGCTGCGGTCTCTTATAGAGCCGATCCGTCGCATTATCGGCCGAGTTCATGGACACTTCCTC
TGTGCCAAGGCCGAGGATGTCGTCTTTACCGATAGACTCGTTGAGGTCTCGCAGCTGGATTCCAACGGAAAAGAG
AGTCGGTTCTACGTGCCGTACGACAAGCTCGTCATTGCTGTCGGGTCCGTCACCAACCCTCACGGCGTCAAGGGT
CTCGACAATGCCTTCTTCCTCAAGGATCTGGAAGACTCGCGCAGGATTCGAAGCCGTGTCGTTCGCAACCTCGAG
CTCGCCTGTTTGCCGACGACGACTGATGACGAGCGCAAACGTCTGCTTTCCTTTGTCATTTGCGGTGGTGGCCCT
ACGGGAGTCGAGGTGGCGGCTGAGTTGTTTGATCTACTCAACGAAGATCTAACGCGCATGTTTCCCCGACTACTG
AGGAACGAGATTTCAGTCCATCTTATCCAGAGCCGGAGTCACATCCTCAACACGTACGACGAGGCCGTCTCGCAC
TACGCCGAGAAGCGATTCGCCCGCGACCAGGTCGAGGTGCTCACCAACTCCAGGGTAAAGGAGGTGCTACCAGAC
AAGATCATCTTCTCCCAGAAGCAGGCGGACGGCTCCATCGTGACCAAGGAGCTACCAGCCGGCTTCTGTCTCTGG
TCGACGGGCCTCGCGCAGACGCATCTTTGTCAGAAACTGGCACGACGATTGGGTGACTTCCAGCCAAACCGACAC
GCGCTCGAGACGGACACGCACCTGCGCGTCAAGGGAACGCCTCTGGGCGACGTCTACGCCATTGGCGATTGCTCA
ACGGTACAGAACAACGTGGCCGACCACGTCATCAACTTCCTCCGCGCCTACGCCTGGAAACGCGGCAAGGACCCA
GAAACGATCCAACTCAGCTTCAGCGACTGGCAGCACGTAGCACGCGACGTGAAGAAGCGCTTCCCCCAATCAGTA
AACCACCTCCGCCGCCTCGACAAGCTCTTCTCCGAATTCGATAAAGACGAGTCCGGTACCCTCGACCTAGGCGAA
CTCCGCGAACTCCTCGGCCAAATCGACAGCAAGCTAACCTCCCTGCCCGCCACCGCCCAACGCGCCCACCAGCAG
GGCTCCTACCTGGCCGTCAAGCTGCACCGCCTAGCCCGCATGTCAGACGGGCTCAGCGCAAACGACATCCGCGAC
GGCGACGTCGACGCCGCTGCCTACCGTGCCTTTGAGTATCGTCATCTCGGAAGCTTGGCTTACCTCGGCAACGCG
GCCGTCTTTGATCTCGGGCGTGGCGGGTGGAGTGTTGCGGGGGGGCTTTGGGCTGTGTACGCCTGGCGATCTGTT
TATTTTGCGCAGAGTGTTAGCTTTAGGACGAGGTCGCTCATGGCTATGGATTGGGCGAAGAGGGCTTTGTTCGGA
AGAGGTTTGTTGCATCTCCTGCTGTTGTTTGTTTCCATGGAGGGTTTGATATGGTTTTTTGCTGACTTGTCGTGT
AGACTTTGCGAGTCTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail