Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05593
Gene name
Locationscaffold_06:637168..638024
Strand-
Gene length (bp)856
Transcript length (bp)624
Coding sequence length (bp)624
Protein length (aa) 208

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00071 Ras Ras family 1.0E-59 16 174
PF08477 Roc Ras of Complex, Roc, domain of DAPkinase 3.9E-37 16 130
PF00025 Arf ADP-ribosylation factor family 2.9E-18 12 174
PF01926 MMR_HSR1 50S ribosome-binding GTPase 4.9E-05 17 124

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0003824 catalytic activity No
GO:0016462 pyrophosphatase activity No
GO:0097159 organic cyclic compound binding No
GO:0019001 guanyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:1901265 nucleoside phosphate binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0043167 ion binding No
GO:0097367 carbohydrate derivative binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane|Lysosome/Vacuole|Golgi apparatus 0.4021 0.1553 0.0315 0.5312 0.105 0.0046 0.3119 0.662 0.7411 0.0148

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5725
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7118
Ophiocordyceps australis map64 (Brazil) OphauB2|5502
Ophiocordyceps camponoti-floridani Ophcf2|05593 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7327
Ophiocordyceps kimflemingae Ophio5|3203
Ophiocordyceps subramaniannii Hirsu2|8974

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05593
MAQAGGSFNNPLKKFKLVFLGEQSVGKTSLITRFMYDSFDNMYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQER
FRSLIPSYIRDSSVAVVVYDISNAKSFQNTKKWIDDVRAERGNDVIIVLVGNKTDLNDKREVTTQQGEDEAKKNN
LMFMETSAKLGHNVKNLFKRIAQALPGMEGTDAAAQASNQMIDVKSQPQTAPDGCSC*
Coding >Ophcf2|05593
ATGGCTCAAGCAGGCGGCTCTTTCAATAATCCCCTCAAGAAGTTCAAGCTTGTCTTCTTGGGGGAACAGAGCGTC
GGCAAGACGTCGTTGATCACGAGGTTCATGTACGACTCCTTCGATAACATGTATCAAGCCACGATTGGCATCGAT
TTCCTCTCCAAGACCATGTATCTCGAAGACCGGACAGTGAGGCTGCAATTATGGGACACAGCAGGTCAGGAGAGG
TTTCGAAGTCTGATTCCGTCTTACATCCGCGACTCGAGCGTTGCCGTCGTAGTCTACGACATCTCCAACGCAAAG
TCCTTCCAAAACACAAAGAAATGGATCGACGACGTCAGAGCCGAGCGAGGAAACGACGTCATCATCGTTCTGGTC
GGCAACAAGACTGATCTGAACGACAAGCGCGAAGTCACCACCCAGCAAGGCGAAGACGAAGCCAAGAAGAACAAC
TTGATGTTTATGGAAACGAGCGCGAAGCTCGGACACAACGTCAAGAACCTCTTCAAGAGGATAGCACAGGCTCTG
CCCGGCATGGAGGGCACCGACGCCGCGGCGCAAGCTTCGAACCAGATGATTGATGTCAAAAGCCAACCGCAGACA
GCCCCGGACGGCTGCTCCTGTTGA
Transcript >Ophcf2|05593
ATGGCTCAAGCAGGCGGCTCTTTCAATAATCCCCTCAAGAAGTTCAAGCTTGTCTTCTTGGGGGAACAGAGCGTC
GGCAAGACGTCGTTGATCACGAGGTTCATGTACGACTCCTTCGATAACATGTATCAAGCCACGATTGGCATCGAT
TTCCTCTCCAAGACCATGTATCTCGAAGACCGGACAGTGAGGCTGCAATTATGGGACACAGCAGGTCAGGAGAGG
TTTCGAAGTCTGATTCCGTCTTACATCCGCGACTCGAGCGTTGCCGTCGTAGTCTACGACATCTCCAACGCAAAG
TCCTTCCAAAACACAAAGAAATGGATCGACGACGTCAGAGCCGAGCGAGGAAACGACGTCATCATCGTTCTGGTC
GGCAACAAGACTGATCTGAACGACAAGCGCGAAGTCACCACCCAGCAAGGCGAAGACGAAGCCAAGAAGAACAAC
TTGATGTTTATGGAAACGAGCGCGAAGCTCGGACACAACGTCAAGAACCTCTTCAAGAGGATAGCACAGGCTCTG
CCCGGCATGGAGGGCACCGACGCCGCGGCGCAAGCTTCGAACCAGATGATTGATGTCAAAAGCCAACCGCAGACA
GCCCCGGACGGCTGCTCCTGTTGA
Gene >Ophcf2|05593
ATGGCTCAAGCAGGCGGCTCTTTCAATAATCCCCTCAAGAAGTTCAAGCTTGTCTTCTTGGGGGAACAGAGCGGT
AAGCGTTCCCCGTCGATGCCCTGGGACTGCCGCGCCGACTGACGTGCATGCTTCCTCAAGTCGGCAAGACGTCGT
TGATCACGAGGTTCATGTACGACTCCTTCGATAACATGTATCAAGCCACGATTGGCATCGATTTCCTCTCCAAGG
TCAGCTATCCACCTGCGTCATGGCAACCTGCCGAATGCTGACGGGCTGACGGCAGACCATGTATCTCGAAGACCG
GACAGTGAGGCTGCAATTATGGGACACAGCAGGTCAGGAGAGGTTTCGAAGTCTGATTCCGTCTTACATCCGCGA
CTCGAGCGTTGCCGTCGTAGTCTACGACATCTCCAGTCTGTCAAGCCCCCCCCCCCCCCCCCCCCCCTGAGCCAA
CATGGGCTGACGAAGAACAGACGCAAAGTCCTTCCAAAACACAAAGAAATGGATCGACGACGTCAGAGCCGAGCG
AGGAAACGACGTCATCATCGTTCTGGTCGGCAACAAGACTGATCTGAACGACAAGCGCGAAGTCACCACCCAGCA
AGGCGAAGACGAAGCCAAGAAGAACAACTTGATGTTTATGGAAACGAGCGCGAAGCTCGGACACAACGTCAAGAA
CCTCTTCAAGAGGATAGCACAGGCTCTGCCCGGCATGGAGGGCACCGACGCCGCGGCGCAAGCTTCGAACCAGAG
TGAGTTCATACCCAATCACGCAGCCGACCCTTGCTTCTGACACGTCTTCACAGTGATTGATGTCAAAAGCCAACC
GCAGACAGCCCCGGACGGCTGCTCCTGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail