Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05580
Gene name
Locationscaffold_06:608389..610206
Strand+
Gene length (bp)1817
Transcript length (bp)1683
Coding sequence length (bp)1683
Protein length (aa) 561

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12813 XPG_I_2 XPG domain containing 1.7E-51 110 343

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3858 0.9115 0.0593 0.0425 0.1591 0.0021 0.015 0.0271 0.0217 0.0125

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5610
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7139
Ophiocordyceps australis map64 (Brazil) OphauB2|1124
Ophiocordyceps camponoti-floridani Ophcf2|05580 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7597
Ophiocordyceps kimflemingae Ophio5|2802
Ophiocordyceps subramaniannii Hirsu2|7594

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05580
MGIPHLATSLQRFANHRALQDESVVIDGPALAHHMLNICRVNDASPPSYNLIAKSYIRWLDGLYSHRVIIEAIYF
DGHLPSWKRTVAVDDRDQLDDVFATGTCGFRPFVEPSFFVPAIIESLRQHPRYKTVTFVVPGEADAYCAAHVSQM
GGLVLTSDSDLLVYNLREGQVAFLRDIYQNTYAQIVGSVFSPKQIGANLKLPPSEGLLRLAYEHSRAPQSTLSAI
YQSCSREITNHSGYEKFSKLYELPAISLWHPLDKKRFRRLVALDPRVSEVAVRISSKISTNPDHADDVHMYLPLL
LEDSSSGSAWEHSRPLRQLAYAVFQLLNPRREMEVLEYRRVQDVSQKGRSVERLSTKQIEHLSEAFLIIIERMKS
MAITYSISPWHLVGMAIEANECQTLEKQSFTWSILQMRHDPSMTKTDRIPWNILHFSAHLQAALYSLRMLSQALI
TFSEMSPDRGLPWSARQLQFELRQLPPLADFPDVDDAMQLLLLPSKDALIEEFGAALHLTMAPASESQTPAKTKK
RAASEQREDGSRTSLPGSKRAMNANMFGLLSIESD*
Coding >Ophcf2|05580
ATGGGCATTCCACATCTCGCCACTTCGTTGCAACGTTTCGCCAACCACCGGGCATTGCAGGACGAATCCGTCGTC
ATCGATGGCCCAGCTCTAGCACATCATATGCTCAACATTTGCAGAGTGAACGACGCGTCTCCACCATCTTATAAC
CTCATCGCAAAATCCTATATAAGATGGTTGGATGGACTGTACAGCCATCGAGTCATCATTGAGGCCATTTACTTT
GACGGTCATCTGCCGTCATGGAAACGAACTGTGGCTGTCGATGACAGAGACCAGCTCGACGATGTCTTCGCCACG
GGCACCTGTGGTTTTCGACCCTTCGTCGAACCCAGCTTCTTTGTCCCGGCCATTATTGAGTCTCTGAGACAGCAT
CCCAGATATAAGACCGTCACCTTCGTCGTACCCGGAGAGGCAGACGCCTATTGTGCGGCTCATGTGTCACAGATG
GGCGGCCTCGTACTGACAAGTGATTCGGATTTGCTCGTCTACAATCTCCGCGAGGGACAGGTCGCCTTCTTGCGC
GACATCTACCAGAATACCTACGCGCAAATCGTGGGCTCCGTCTTTTCCCCGAAGCAAATAGGTGCGAACCTGAAA
CTACCGCCCTCCGAAGGCCTTCTCCGTCTGGCCTACGAGCACAGCAGAGCGCCCCAGTCCACTTTATCGGCGATC
TACCAATCCTGTTCGCGGGAAATCACCAATCACTCCGGTTACGAAAAGTTCAGCAAGCTGTACGAACTCCCAGCC
ATAAGTCTTTGGCACCCATTAGACAAAAAACGCTTTCGTCGACTCGTGGCTCTCGACCCGAGAGTTTCCGAAGTT
GCCGTTCGGATCAGCTCCAAAATTTCGACAAACCCGGATCACGCCGACGATGTTCACATGTATCTCCCCTTACTC
CTGGAAGACTCTAGCTCTGGAAGCGCGTGGGAACACAGCAGGCCCCTGCGCCAGCTAGCCTACGCCGTATTTCAG
CTATTGAACCCCAGACGAGAAATGGAAGTCTTGGAATACAGACGGGTCCAGGACGTGTCGCAGAAAGGGAGAAGC
GTCGAGAGATTGTCCACGAAGCAGATCGAGCATCTCAGTGAAGCGTTCTTAATCATCATCGAGCGCATGAAAAGC
ATGGCAATTACCTACTCGATTTCTCCTTGGCATCTCGTCGGCATGGCCATCGAAGCAAACGAATGCCAAACGCTG
GAAAAGCAGTCTTTCACGTGGAGCATCCTCCAAATGCGACATGACCCGTCCATGACCAAGACCGACAGAATTCCC
TGGAATATCCTGCACTTTTCTGCGCATCTACAAGCGGCGCTCTACTCGCTTCGAATGCTCTCGCAGGCGCTGATC
ACCTTTTCGGAGATGTCACCTGACAGAGGTCTTCCTTGGTCTGCGCGACAGCTGCAGTTCGAACTGCGGCAGCTT
CCTCCGTTGGCCGACTTTCCAGACGTCGATGACGCGATGCAGCTTCTCCTTCTACCGAGTAAGGACGCGCTGATT
GAGGAATTCGGAGCAGCGCTTCACTTAACCATGGCACCCGCGTCAGAGTCTCAAACCCCAGCCAAAACCAAGAAG
CGGGCTGCAAGTGAGCAAAGGGAAGACGGCTCTCGAACCTCGCTACCCGGTTCTAAGCGGGCCATGAATGCCAAC
ATGTTTGGACTCCTATCCATCGAGTCAGACTAA
Transcript >Ophcf2|05580
ATGGGCATTCCACATCTCGCCACTTCGTTGCAACGTTTCGCCAACCACCGGGCATTGCAGGACGAATCCGTCGTC
ATCGATGGCCCAGCTCTAGCACATCATATGCTCAACATTTGCAGAGTGAACGACGCGTCTCCACCATCTTATAAC
CTCATCGCAAAATCCTATATAAGATGGTTGGATGGACTGTACAGCCATCGAGTCATCATTGAGGCCATTTACTTT
GACGGTCATCTGCCGTCATGGAAACGAACTGTGGCTGTCGATGACAGAGACCAGCTCGACGATGTCTTCGCCACG
GGCACCTGTGGTTTTCGACCCTTCGTCGAACCCAGCTTCTTTGTCCCGGCCATTATTGAGTCTCTGAGACAGCAT
CCCAGATATAAGACCGTCACCTTCGTCGTACCCGGAGAGGCAGACGCCTATTGTGCGGCTCATGTGTCACAGATG
GGCGGCCTCGTACTGACAAGTGATTCGGATTTGCTCGTCTACAATCTCCGCGAGGGACAGGTCGCCTTCTTGCGC
GACATCTACCAGAATACCTACGCGCAAATCGTGGGCTCCGTCTTTTCCCCGAAGCAAATAGGTGCGAACCTGAAA
CTACCGCCCTCCGAAGGCCTTCTCCGTCTGGCCTACGAGCACAGCAGAGCGCCCCAGTCCACTTTATCGGCGATC
TACCAATCCTGTTCGCGGGAAATCACCAATCACTCCGGTTACGAAAAGTTCAGCAAGCTGTACGAACTCCCAGCC
ATAAGTCTTTGGCACCCATTAGACAAAAAACGCTTTCGTCGACTCGTGGCTCTCGACCCGAGAGTTTCCGAAGTT
GCCGTTCGGATCAGCTCCAAAATTTCGACAAACCCGGATCACGCCGACGATGTTCACATGTATCTCCCCTTACTC
CTGGAAGACTCTAGCTCTGGAAGCGCGTGGGAACACAGCAGGCCCCTGCGCCAGCTAGCCTACGCCGTATTTCAG
CTATTGAACCCCAGACGAGAAATGGAAGTCTTGGAATACAGACGGGTCCAGGACGTGTCGCAGAAAGGGAGAAGC
GTCGAGAGATTGTCCACGAAGCAGATCGAGCATCTCAGTGAAGCGTTCTTAATCATCATCGAGCGCATGAAAAGC
ATGGCAATTACCTACTCGATTTCTCCTTGGCATCTCGTCGGCATGGCCATCGAAGCAAACGAATGCCAAACGCTG
GAAAAGCAGTCTTTCACGTGGAGCATCCTCCAAATGCGACATGACCCGTCCATGACCAAGACCGACAGAATTCCC
TGGAATATCCTGCACTTTTCTGCGCATCTACAAGCGGCGCTCTACTCGCTTCGAATGCTCTCGCAGGCGCTGATC
ACCTTTTCGGAGATGTCACCTGACAGAGGTCTTCCTTGGTCTGCGCGACAGCTGCAGTTCGAACTGCGGCAGCTT
CCTCCGTTGGCCGACTTTCCAGACGTCGATGACGCGATGCAGCTTCTCCTTCTACCGAGTAAGGACGCGCTGATT
GAGGAATTCGGAGCAGCGCTTCACTTAACCATGGCACCCGCGTCAGAGTCTCAAACCCCAGCCAAAACCAAGAAG
CGGGCTGCAAGTGAGCAAAGGGAAGACGGCTCTCGAACCTCGCTACCCGGTTCTAAGCGGGCCATGAATGCCAAC
ATGTTTGGACTCCTATCCATCGAGTCAGACTAA
Gene >Ophcf2|05580
ATGGGCATTCCACATCTCGCCACTTCGTTGCAACGTTTCGCCAACCACCGGGCATTGCAGGACGAATCCGTCGTC
ATCGATGGCCCAGCTCTAGCACATCATATGCTCAACATTTGCAGAGTGAACGACGCGTCTCCACCATCTTATAAC
CTCATCGCAAAATCCTATATAAGATGGTTGGATGGACTGTACAGCCATCGAGTCATCATGTAAGGGATCCTTCAC
TCTTCGCAGACGTTGCCCGGACTAACCCTGTCAGTGAGGCCATTTACTTTGACGGTCATCTGCCGTCATGGAAAC
GAACTGTACGCATGGAGAGAGTGAAAAGTCGCTCGTCTCAACTTACGAAGCTACACTCATGGCATCCAGAAGGCT
GTCCGAGAAAACAGGTGGCTGTCGATGACAGAGACCAGCTCGACGATGTCTTCGCCACGGGCACCTGTGGTTTTC
GACCCTTCGTCGAACCCAGCTTCTTTGTCCCGGCCATTATTGAGTCTCTGAGACAGCATCCCAGATATAAGACCG
TCACCTTCGTCGTACCCGGAGAGGCAGACGCCTATTGTGCGGCTCATGTGTCACAGATGGGCGGCCTCGTACTGA
CAAGTGATTCGGATTTGCTCGTCTACAATCTCCGCGAGGGACAGGTCGCCTTCTTGCGCGACATCTACCAGAATA
CCTACGCGCAAATCGTGGGCTCCGTCTTTTCCCCGAAGCAAATAGGTGCGAACCTGAAACTACCGCCCTCCGAAG
GCCTTCTCCGTCTGGCCTACGAGCACAGCAGAGCGCCCCAGTCCACTTTATCGGCGATCTACCAATCCTGTTCGC
GGGAAATCACCAATCACTCCGGTTACGAAAAGTTCAGCAAGCTGTACGAACTCCCAGCCATAAGTCTTTGGCACC
CATTAGACAAAAAACGCTTTCGTCGACTCGTGGCTCTCGACCCGAGAGTTTCCGAAGTTGCCGTTCGGATCAGCT
CCAAAATTTCGACAAACCCGGATCACGCCGACGATGTTCACATGTATCTCCCCTTACTCCTGGAAGACTCTAGCT
CTGGAAGCGCGTGGGAACACAGCAGGCCCCTGCGCCAGCTAGCCTACGCCGTATTTCAGCTATTGAACCCCAGAC
GAGAAATGGAAGTCTTGGAATACAGACGGGTCCAGGACGTGTCGCAGAAAGGGAGAAGCGTCGAGAGATTGTCCA
CGAAGCAGATCGAGCATCTCAGTGAAGCGTTCTTAATCATCATCGAGCGCATGAAAAGCATGGCAATTACCTACT
CGATTTCTCCTTGGCATCTCGTCGGCATGGCCATCGAAGCAAACGAATGCCAAACGCTGGAAAAGCAGTCTTTCA
CGTGGAGCATCCTCCAAATGCGACATGACCCGTCCATGACCAAGACCGACAGAATTCCCTGGAATATCCTGCACT
TTTCTGCGCATCTACAAGCGGCGCTCTACTCGCTTCGAATGCTCTCGCAGGCGCTGATCACCTTTTCGGAGATGT
CACCTGACAGAGGTCTTCCTTGGTCTGCGCGACAGCTGCAGTTCGAACTGCGGCAGCTTCCTCCGTTGGCCGACT
TTCCAGACGTCGATGACGCGATGCAGCTTCTCCTTCTACCGAGTAAGGACGCGCTGATTGAGGAATTCGGAGCAG
CGCTTCACTTAACCATGGCACCCGCGTCAGAGTCTCAAACCCCAGCCAAAACCAAGAAGCGGGCTGCAAGTGAGC
AAAGGGAAGACGGCTCTCGAACCTCGCTACCCGGTTCTAAGCGGGCCATGAATGCCAACATGTTTGGACTCCTAT
CCATCGAGTCAGACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail