Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05579
Gene name
Locationscaffold_06:606546..608081
Strand-
Gene length (bp)1535
Transcript length (bp)1416
Coding sequence length (bp)1416
Protein length (aa) 472

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13793 Pribosyltran_N N-terminal domain of ribose phosphate pyrophosphokinase 2.7E-42 5 120
PF14572 Pribosyl_synth Phosphoribosyl synthetase-associated domain 4.0E-28 344 466

GO

GO Term Description Terminal node
GO:0004749 ribose phosphate diphosphokinase activity Yes
GO:0000287 magnesium ion binding Yes
GO:0009165 nucleotide biosynthetic process Yes
GO:0046483 heterocycle metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0005488 binding No
GO:0016740 transferase activity No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043169 cation binding No
GO:0016778 diphosphotransferase activity No
GO:0003824 catalytic activity No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0008152 metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0009987 cellular process No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0044237 cellular metabolic process No
GO:0009117 nucleotide metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0019438 aromatic compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0090407 organophosphate biosynthetic process No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0044281 small molecule metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6173 0.4884 0.0248 0.1658 0.1452 0.0029 0.1487 0.0647 0.0821 0.0009

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5611
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4466
Ophiocordyceps australis map64 (Brazil) OphauB2|1123
Ophiocordyceps camponoti-floridani Ophcf2|05579 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7598
Ophiocordyceps kimflemingae Ophio5|2803
Ophiocordyceps subramaniannii Hirsu2|7595

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05579
MRNTLIFAGNSCPALTGQICEHLGMYPAHAELTQFSNGETSVRILTSVREKDVFVVQSGSARVNDSIMELLIMIS
ACKGGSANKITAVLPYFPYSRQSKKKSHRGAITARMLANLLGVAGVKHVITVDLHASQMQGFFKCPVDNLHAEPI
IATWVRGNVPNWREAVVVSKNAGGTKRVTSLADALKLNFGMVTTDRKRGISMTGSATLNPPDAENGRAVKPETIR
SSRTIADSNGSPVRRTETPRKTANGSPRPASASTKTPPQQSRRLSTTDADYHDERVREVIHGRLVQGHLVEDNFP
SPERSTEHSVTDDDPMSMSHASSYFAHERQSHGDPAASSDEEDNAFQNTKDEHMITLVGNVRERAVLIVDDMIDK
PGSWIAAAETVVKKGSAKKVYCIATHGVFGGDCLQQLQECECIDTIVVTNSFPISQETARSCSKLVILDLSSLLA
EAIRRNHYGESISPLFLHGGD*
Coding >Ophcf2|05579
ATGCGCAACACCCTCATTTTCGCGGGCAACTCGTGCCCGGCTCTGACAGGGCAAATATGCGAGCATCTGGGCATG
TATCCCGCTCACGCGGAGTTGACGCAGTTCTCCAACGGAGAGACGAGTGTGCGGATTCTGACGAGTGTGCGTGAG
AAGGACGTGTTTGTTGTTCAATCTGGCAGCGCGAGGGTCAACGACTCCATCATGGAGCTTCTCATCATGATTTCC
GCCTGCAAAGGCGGCTCGGCCAACAAGATCACAGCCGTTCTTCCCTACTTCCCATACAGTCGACAGTCCAAGAAG
AAGTCGCACAGAGGTGCAATCACGGCACGCATGCTGGCCAATCTGCTGGGAGTTGCTGGCGTTAAGCACGTCATC
ACTGTCGACCTGCATGCGTCGCAGATGCAGGGCTTCTTCAAGTGTCCCGTCGACAACCTCCACGCCGAGCCCATC
ATAGCCACGTGGGTTCGGGGCAACGTTCCCAACTGGCGCGAAGCTGTCGTCGTCTCTAAAAACGCTGGTGGAACA
AAGCGAGTCACGTCGCTTGCCGACGCCCTCAAGCTCAACTTTGGCATGGTTACGACCGACAGGAAGCGTGGCATC
AGCATGACGGGGAGTGCAACCTTGAATCCTCCCGACGCGGAAAATGGCCGAGCTGTCAAGCCTGAAACCATACGA
AGCTCCAGGACAATTGCAGATTCCAACGGCTCACCTGTGCGGCGGACCGAGACGCCTCGAAAGACAGCAAACGGC
AGCCCTCGGCCTGCTTCTGCGTCGACGAAGACGCCGCCACAGCAGTCGCGCCGGCTTTCCACTACCGACGCAGAT
TACCATGACGAACGTGTTCGCGAGGTAATCCATGGTCGTCTGGTTCAAGGTCACCTTGTCGAAGATAATTTCCCT
TCCCCTGAACGGTCTACCGAGCACAGCGTGACGGATGACGACCCCATGTCCATGTCGCACGCCTCGTCTTACTTC
GCTCACGAGCGGCAAAGCCACGGCGACCCTGCGGCCAGTTCTGACGAGGAAGACAATGCCTTTCAGAACACCAAA
GACGAGCACATGATTACTTTGGTGGGAAACGTCCGGGAACGAGCTGTCTTGATTGTTGATGACATGATTGACAAG
CCAGGCTCGTGGATTGCTGCGGCCGAGACTGTCGTCAAGAAAGGGTCCGCCAAGAAGGTCTACTGCATTGCCACG
CACGGCGTCTTTGGCGGAGATTGCCTGCAGCAATTGCAAGAATGCGAGTGCATCGACACCATTGTCGTCACCAAC
AGCTTTCCCATCAGTCAGGAGACGGCAAGAAGCTGTAGCAAGCTTGTTATCCTGGATCTCTCGTCCCTGCTCGCA
GAAGCCATCCGCCGCAACCACTACGGCGAGTCCATATCCCCCCTGTTTCTTCATGGCGGAGACTGA
Transcript >Ophcf2|05579
ATGCGCAACACCCTCATTTTCGCGGGCAACTCGTGCCCGGCTCTGACAGGGCAAATATGCGAGCATCTGGGCATG
TATCCCGCTCACGCGGAGTTGACGCAGTTCTCCAACGGAGAGACGAGTGTGCGGATTCTGACGAGTGTGCGTGAG
AAGGACGTGTTTGTTGTTCAATCTGGCAGCGCGAGGGTCAACGACTCCATCATGGAGCTTCTCATCATGATTTCC
GCCTGCAAAGGCGGCTCGGCCAACAAGATCACAGCCGTTCTTCCCTACTTCCCATACAGTCGACAGTCCAAGAAG
AAGTCGCACAGAGGTGCAATCACGGCACGCATGCTGGCCAATCTGCTGGGAGTTGCTGGCGTTAAGCACGTCATC
ACTGTCGACCTGCATGCGTCGCAGATGCAGGGCTTCTTCAAGTGTCCCGTCGACAACCTCCACGCCGAGCCCATC
ATAGCCACGTGGGTTCGGGGCAACGTTCCCAACTGGCGCGAAGCTGTCGTCGTCTCTAAAAACGCTGGTGGAACA
AAGCGAGTCACGTCGCTTGCCGACGCCCTCAAGCTCAACTTTGGCATGGTTACGACCGACAGGAAGCGTGGCATC
AGCATGACGGGGAGTGCAACCTTGAATCCTCCCGACGCGGAAAATGGCCGAGCTGTCAAGCCTGAAACCATACGA
AGCTCCAGGACAATTGCAGATTCCAACGGCTCACCTGTGCGGCGGACCGAGACGCCTCGAAAGACAGCAAACGGC
AGCCCTCGGCCTGCTTCTGCGTCGACGAAGACGCCGCCACAGCAGTCGCGCCGGCTTTCCACTACCGACGCAGAT
TACCATGACGAACGTGTTCGCGAGGTAATCCATGGTCGTCTGGTTCAAGGTCACCTTGTCGAAGATAATTTCCCT
TCCCCTGAACGGTCTACCGAGCACAGCGTGACGGATGACGACCCCATGTCCATGTCGCACGCCTCGTCTTACTTC
GCTCACGAGCGGCAAAGCCACGGCGACCCTGCGGCCAGTTCTGACGAGGAAGACAATGCCTTTCAGAACACCAAA
GACGAGCACATGATTACTTTGGTGGGAAACGTCCGGGAACGAGCTGTCTTGATTGTTGATGACATGATTGACAAG
CCAGGCTCGTGGATTGCTGCGGCCGAGACTGTCGTCAAGAAAGGGTCCGCCAAGAAGGTCTACTGCATTGCCACG
CACGGCGTCTTTGGCGGAGATTGCCTGCAGCAATTGCAAGAATGCGAGTGCATCGACACCATTGTCGTCACCAAC
AGCTTTCCCATCAGTCAGGAGACGGCAAGAAGCTGTAGCAAGCTTGTTATCCTGGATCTCTCGTCCCTGCTCGCA
GAAGCCATCCGCCGCAACCACTACGGCGAGTCCATATCCCCCCTGTTTCTTCATGGCGGAGACTGA
Gene >Ophcf2|05579
ATGCGCAACACCCTCATTTTCGCGGGCAACTCGTGCCCGGCTCTGACAGGGCAAATATGCGAGCATCTGGGCATG
TATCCCGCTCACGCGGAGTTGACGCAGTTCTCCAACGTGAGCTCCATCTTTCCGTCGCGCCTTGACCTGCGGGCT
AACTCTTGGTATAGGGAGAGACGAGTGTGCGGATTCTGACGAGTGTGCGTGAGAAGGACGTGTTTGTTGTTCAAT
CTGGCAGCGCGAGGGTCAACGACTCCATCATGGAGCTTCTCATCATGATTTCCGCCTGCAAAGGCGGCTCGGCCA
ACAAGATCACAGGTAGGTGGTTCTCGGAAGATGCCTTTACGACAGTTTACTGACGCTCCGGTCTTTTGATCCTGG
CAGCCGTTCTTCCCTACTTCCCATACAGTCGACAGTCCAAGAAGAAGTCGCACAGAGGTGCAATCACGGCACGCA
TGCTGGCCAATCTGCTGGGAGTTGCTGGCGTTAAGCACGTCATCACTGTCGACCTGCATGCGTCGCAGATGCAGG
GCTTCTTCAAGTGTCCCGTCGACAACCTCCACGCCGAGCCCATCATAGCCACGTGGGTTCGGGGCAACGTTCCCA
ACTGGCGCGAAGCTGTCGTCGTCTCTAAAAACGCTGGTGGAACAAAGCGAGTCACGTCGCTTGCCGACGCCCTCA
AGCTCAACTTTGGCATGGTTACGACCGACAGGAAGCGTGGCATCAGCATGACGGGGAGTGCAACCTTGAATCCTC
CCGACGCGGAAAATGGCCGAGCTGTCAAGCCTGAAACCATACGAAGCTCCAGGACAATTGCAGATTCCAACGGCT
CACCTGTGCGGCGGACCGAGACGCCTCGAAAGACAGCAAACGGCAGCCCTCGGCCTGCTTCTGCGTCGACGAAGA
CGCCGCCACAGCAGTCGCGCCGGCTTTCCACTACCGACGCAGATTACCATGACGAACGTGTTCGCGAGGTAATCC
ATGGTCGTCTGGTTCAAGGTCACCTTGTCGAAGATAATTTCCCTTCCCCTGAACGGTCTACCGAGCACAGCGTGA
CGGATGACGACCCCATGTCCATGTCGCACGCCTCGTCTTACTTCGCTCACGAGCGGCAAAGCCACGGCGACCCTG
CGGCCAGTTCTGACGAGGAAGACAATGCCTTTCAGAACACCAAAGACGAGCACATGATTACTTTGGTGGGAAACG
TCCGGGAACGAGCTGTCTTGATTGTTGATGACATGATTGACAAGCCAGGCTCGTGGATTGCTGCGGCCGAGACTG
TCGTCAAGAAAGGGTCCGCCAAGAAGGTCTACTGCATTGCCACGCACGGCGTCTTTGGCGGAGATTGCCTGCAGC
AATTGCAAGAATGCGAGTGCATCGACACCATTGTCGTCACCAACAGCTTTCCCATCAGTCAGGAGACGGCAAGAA
GCTGTAGCAAGCTTGTTATCCTGGATCTCTCGTCCCTGCTCGCAGAAGCCATCCGCCGCAACCACTACGGCGAGT
CCATATCCCCCCTGTTTCTTCATGGCGGAGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail