Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05576
Gene name
Locationscaffold_06:601189..602575
Strand+
Gene length (bp)1386
Transcript length (bp)1386
Coding sequence length (bp)1386
Protein length (aa) 462

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.57 0.4599 0.0964 0.1381 0.44 0.0049 0.1763 0.4139 0.0799 0.0259

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup377
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1721
Ophiocordyceps australis 1348a (Ghana) OphauG2|6957
Ophiocordyceps australis map64 (Brazil) OphauB2|7725
Ophiocordyceps camponoti-floridani Ophcf2|05576 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7602
Ophiocordyceps kimflemingae Ophio5|2612
Ophiocordyceps subramaniannii Hirsu2|1069
Ophiocordyceps subramaniannii Hirsu2|5673
Ophiocordyceps subramaniannii Hirsu2|5701

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05576
MAILNQSHDILLCILDLLPPPSLNSTSKLTKPIRSVTEARLYNSVTAAWAPASVPPSTALLLRTLLQRPDLSRRV
RHLRLVGDGFGDEVRVCEPPSFILDSASLARASALISATGVSFADTWISELRSGSMDAMVATLLATMPKLETLHL
DPNFTVKSRVLGSLFQSILVKTQDNHHHHHHHHHHHHHHHHYQLPSFQNLRNVTFSRRFNEHLQLYINNSADLLP
LFYLPNLQHLSISLDNPPCFDWPSEAPRASSLKSLEVSRLREAPLASLLAPLSELQRLRWNCFYQPDLDQGISTN
VMQLDVMMKAFHQVRHTLTDLTVTAETRRSIMAFYEPPPVQIRGSLDGMRHLGALRRLSIPWVLLMGFSESSTCL
RLSLPSSLEELVLTDDLADKGQWQWYDDSIVSAIKSRLECWDRPKDSSLRRIVLPIPLQGGQMTAGRREQLREIG
DDIRLELAWTE*
Coding >Ophcf2|05576
ATGGCCATCCTCAACCAATCCCACGACATCCTCCTCTGCATCCTCGACCTCCTCCCCCCCCCTTCCCTCAACTCC
ACAAGCAAGCTCACCAAGCCCATCCGTTCCGTAACCGAAGCCCGTCTCTACAACTCCGTCACAGCCGCCTGGGCA
CCAGCATCCGTCCCGCCCTCGACAGCCCTCCTTCTCCGCACCCTCCTCCAACGGCCAGACTTATCTCGCCGTGTT
CGTCACCTTCGCCTCGTCGGGGATGGCTTCGGCGATGAGGTCCGCGTGTGTGAGCCGCCGTCTTTCATCCTCGAT
TCGGCTTCCTTGGCTCGGGCTTCGGCCTTGATCTCAGCCACGGGCGTGTCCTTTGCCGATACGTGGATCAGCGAG
CTGCGGTCAGGTTCCATGGATGCCATGGTGGCCACTCTCCTGGCGACGATGCCTAAACTGGAAACGCTCCATCTC
GATCCCAACTTTACGGTGAAGAGCCGCGTGTTGGGAAGCCTCTTCCAAAGCATCCTTGTCAAAACACAAGACAAT
CATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCACTACCAGCTTCCCTCGTTCCAAAACCTC
CGCAACGTCACCTTTTCCCGTAGATTCAACGAGCACCTCCAGCTCTATATAAACAACTCAGCCGATCTCCTTCCC
CTCTTTTACCTCCCTAACCTCCAACACCTCTCCATCTCGCTCGACAATCCCCCGTGCTTCGACTGGCCCTCCGAA
GCACCACGGGCTTCATCTCTCAAGTCCCTCGAGGTATCCAGGCTGCGGGAGGCCCCCCTCGCTTCTCTTCTCGCT
CCCCTCAGCGAGCTTCAGCGCCTGCGCTGGAATTGCTTCTACCAGCCGGATCTAGACCAAGGCATCAGCACAAAC
GTCATGCAGCTCGATGTCATGATGAAGGCCTTCCATCAAGTCCGCCACACACTCACCGACTTGACCGTCACGGCA
GAGACACGTCGCTCCATCATGGCCTTTTACGAGCCTCCTCCCGTTCAAATCAGGGGGTCGCTCGACGGTATGCGT
CACCTCGGCGCCCTGAGACGGCTTTCCATCCCGTGGGTTCTCCTCATGGGCTTCTCCGAATCCTCGACGTGTCTA
CGGCTTTCGCTCCCTTCCAGTCTAGAGGAGCTGGTGTTGACGGACGACCTGGCGGATAAGGGGCAGTGGCAGTGG
TATGATGACTCGATAGTCTCTGCCATAAAGTCCCGACTCGAGTGCTGGGATCGACCGAAGGACTCGAGTCTGCGG
CGTATCGTACTGCCTATCCCGCTGCAAGGCGGTCAGATGACGGCCGGGAGGAGAGAGCAGCTACGGGAGATTGGC
GACGATATAAGACTGGAACTGGCGTGGACGGAATAG
Transcript >Ophcf2|05576
ATGGCCATCCTCAACCAATCCCACGACATCCTCCTCTGCATCCTCGACCTCCTCCCCCCCCCTTCCCTCAACTCC
ACAAGCAAGCTCACCAAGCCCATCCGTTCCGTAACCGAAGCCCGTCTCTACAACTCCGTCACAGCCGCCTGGGCA
CCAGCATCCGTCCCGCCCTCGACAGCCCTCCTTCTCCGCACCCTCCTCCAACGGCCAGACTTATCTCGCCGTGTT
CGTCACCTTCGCCTCGTCGGGGATGGCTTCGGCGATGAGGTCCGCGTGTGTGAGCCGCCGTCTTTCATCCTCGAT
TCGGCTTCCTTGGCTCGGGCTTCGGCCTTGATCTCAGCCACGGGCGTGTCCTTTGCCGATACGTGGATCAGCGAG
CTGCGGTCAGGTTCCATGGATGCCATGGTGGCCACTCTCCTGGCGACGATGCCTAAACTGGAAACGCTCCATCTC
GATCCCAACTTTACGGTGAAGAGCCGCGTGTTGGGAAGCCTCTTCCAAAGCATCCTTGTCAAAACACAAGACAAT
CATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCACTACCAGCTTCCCTCGTTCCAAAACCTC
CGCAACGTCACCTTTTCCCGTAGATTCAACGAGCACCTCCAGCTCTATATAAACAACTCAGCCGATCTCCTTCCC
CTCTTTTACCTCCCTAACCTCCAACACCTCTCCATCTCGCTCGACAATCCCCCGTGCTTCGACTGGCCCTCCGAA
GCACCACGGGCTTCATCTCTCAAGTCCCTCGAGGTATCCAGGCTGCGGGAGGCCCCCCTCGCTTCTCTTCTCGCT
CCCCTCAGCGAGCTTCAGCGCCTGCGCTGGAATTGCTTCTACCAGCCGGATCTAGACCAAGGCATCAGCACAAAC
GTCATGCAGCTCGATGTCATGATGAAGGCCTTCCATCAAGTCCGCCACACACTCACCGACTTGACCGTCACGGCA
GAGACACGTCGCTCCATCATGGCCTTTTACGAGCCTCCTCCCGTTCAAATCAGGGGGTCGCTCGACGGTATGCGT
CACCTCGGCGCCCTGAGACGGCTTTCCATCCCGTGGGTTCTCCTCATGGGCTTCTCCGAATCCTCGACGTGTCTA
CGGCTTTCGCTCCCTTCCAGTCTAGAGGAGCTGGTGTTGACGGACGACCTGGCGGATAAGGGGCAGTGGCAGTGG
TATGATGACTCGATAGTCTCTGCCATAAAGTCCCGACTCGAGTGCTGGGATCGACCGAAGGACTCGAGTCTGCGG
CGTATCGTACTGCCTATCCCGCTGCAAGGCGGTCAGATGACGGCCGGGAGGAGAGAGCAGCTACGGGAGATTGGC
GACGATATAAGACTGGAACTGGCGTGGACGGAATAG
Gene >Ophcf2|05576
ATGGCCATCCTCAACCAATCCCACGACATCCTCCTCTGCATCCTCGACCTCCTCCCCCCCCCTTCCCTCAACTCC
ACAAGCAAGCTCACCAAGCCCATCCGTTCCGTAACCGAAGCCCGTCTCTACAACTCCGTCACAGCCGCCTGGGCA
CCAGCATCCGTCCCGCCCTCGACAGCCCTCCTTCTCCGCACCCTCCTCCAACGGCCAGACTTATCTCGCCGTGTT
CGTCACCTTCGCCTCGTCGGGGATGGCTTCGGCGATGAGGTCCGCGTGTGTGAGCCGCCGTCTTTCATCCTCGAT
TCGGCTTCCTTGGCTCGGGCTTCGGCCTTGATCTCAGCCACGGGCGTGTCCTTTGCCGATACGTGGATCAGCGAG
CTGCGGTCAGGTTCCATGGATGCCATGGTGGCCACTCTCCTGGCGACGATGCCTAAACTGGAAACGCTCCATCTC
GATCCCAACTTTACGGTGAAGAGCCGCGTGTTGGGAAGCCTCTTCCAAAGCATCCTTGTCAAAACACAAGACAAT
CATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCACTACCAGCTTCCCTCGTTCCAAAACCTC
CGCAACGTCACCTTTTCCCGTAGATTCAACGAGCACCTCCAGCTCTATATAAACAACTCAGCCGATCTCCTTCCC
CTCTTTTACCTCCCTAACCTCCAACACCTCTCCATCTCGCTCGACAATCCCCCGTGCTTCGACTGGCCCTCCGAA
GCACCACGGGCTTCATCTCTCAAGTCCCTCGAGGTATCCAGGCTGCGGGAGGCCCCCCTCGCTTCTCTTCTCGCT
CCCCTCAGCGAGCTTCAGCGCCTGCGCTGGAATTGCTTCTACCAGCCGGATCTAGACCAAGGCATCAGCACAAAC
GTCATGCAGCTCGATGTCATGATGAAGGCCTTCCATCAAGTCCGCCACACACTCACCGACTTGACCGTCACGGCA
GAGACACGTCGCTCCATCATGGCCTTTTACGAGCCTCCTCCCGTTCAAATCAGGGGGTCGCTCGACGGTATGCGT
CACCTCGGCGCCCTGAGACGGCTTTCCATCCCGTGGGTTCTCCTCATGGGCTTCTCCGAATCCTCGACGTGTCTA
CGGCTTTCGCTCCCTTCCAGTCTAGAGGAGCTGGTGTTGACGGACGACCTGGCGGATAAGGGGCAGTGGCAGTGG
TATGATGACTCGATAGTCTCTGCCATAAAGTCCCGACTCGAGTGCTGGGATCGACCGAAGGACTCGAGTCTGCGG
CGTATCGTACTGCCTATCCCGCTGCAAGGCGGTCAGATGACGGCCGGGAGGAGAGAGCAGCTACGGGAGATTGGC
GACGATATAAGACTGGAACTGGCGTGGACGGAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail