Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05574
Gene name
Locationscaffold_06:593453..594627
Strand-
Gene length (bp)1174
Transcript length (bp)1056
Coding sequence length (bp)1056
Protein length (aa) 352

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18 2.3E-21 57 301

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1086 0.0652 0.9058 0.0793 0.0751 0.0415 0.1938 0.2231 0.1381 0.0034

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.999714

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH18 5.1E-27 56 305

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup175
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6129
Ophiocordyceps australis 1348a (Ghana) OphauG2|7112
Ophiocordyceps australis map64 (Brazil) OphauB2|5114
Ophiocordyceps australis map64 (Brazil) OphauB2|5509
Ophiocordyceps camponoti-floridani Ophcf2|00800
Ophiocordyceps camponoti-floridani Ophcf2|05574 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1902
Ophiocordyceps camponoti-rufipedis Ophun1|7604
Ophiocordyceps kimflemingae Ophio5|2615
Ophiocordyceps kimflemingae Ophio5|6743
Ophiocordyceps subramaniannii Hirsu2|242
Ophiocordyceps subramaniannii Hirsu2|7599

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05574
MPSLIRFLACCAGLFGLAASVPSRKCRGGVRHSKPSLGISHSNPSNNTSRANASNSIAVYWGQNSYGQGSGPNVQ
QNLAYYCENANIDVIPLAFMNGITPPIVNFANAGDKCSSFNGSTLLRCPEIEADIIKCQAKHKKTIVLSLGGATY
TQGGWATTAEAEKAADMVWAMFGPVSGDYQVDRPFGKAVVDGFDFDFEAYTNNLPAFGARLRSLMDGAGSKKYVL
TAAPQCVFPDAAVGTTLDAVPFDYIFIQFYNNWCGVSNFQPGAPTQQAFNFDVWDAWSKRSKNPSVKLLLGIPAN
VGAGGGYVRGPKLAAIIKYCSDFSSFGGVMMWDVSQLYANPGFLEEIVASL*
Coding >Ophcf2|05574
ATGCCTTCTCTGATTCGTTTCCTCGCCTGCTGCGCGGGCTTATTCGGCCTGGCTGCCTCGGTCCCCTCCCGCAAG
TGCAGGGGGGGTGTCCGCCATTCGAAGCCTTCCCTTGGCATAAGCCATTCCAATCCCTCCAACAATACCAGCCGT
GCAAATGCCTCCAACAGCATAGCCGTCTACTGGGGGCAAAACTCGTACGGCCAGGGCTCCGGTCCCAACGTGCAG
CAGAACCTTGCCTACTACTGCGAGAACGCAAACATCGACGTGATCCCCCTCGCCTTCATGAACGGCATCACGCCC
CCCATCGTCAACTTTGCCAACGCGGGCGACAAGTGCAGCTCCTTCAACGGCTCAACACTCCTCCGCTGCCCCGAA
ATCGAAGCCGACATTATCAAATGCCAGGCCAAGCACAAAAAGACAATCGTTCTCTCCCTCGGCGGCGCAACCTAC
ACCCAGGGCGGCTGGGCGACGACAGCCGAGGCGGAAAAGGCCGCAGACATGGTGTGGGCCATGTTCGGACCCGTC
TCGGGAGACTATCAAGTCGATCGTCCGTTTGGCAAAGCCGTTGTTGACGGCTTCGACTTTGACTTTGAGGCTTAT
ACTAACAACCTGCCTGCTTTCGGAGCCCGGCTTCGATCCCTGATGGACGGAGCTGGCAGTAAGAAGTACGTCCTG
ACAGCGGCGCCTCAGTGCGTCTTCCCCGACGCTGCGGTGGGAACGACGCTCGATGCCGTCCCCTTTGACTACATC
TTCATCCAATTCTACAACAACTGGTGCGGCGTCTCCAACTTCCAGCCAGGAGCCCCCACCCAACAAGCCTTCAAC
TTCGACGTCTGGGACGCCTGGAGCAAGCGCAGCAAGAACCCATCCGTCAAGCTCCTTCTCGGCATCCCCGCCAAC
GTCGGTGCCGGGGGCGGATACGTGCGCGGGCCCAAGCTTGCGGCCATCATCAAGTACTGCTCCGACTTTTCGTCT
TTTGGCGGCGTCATGATGTGGGATGTGAGTCAGTTGTACGCCAATCCGGGGTTTTTGGAGGAGATTGTTGCCAGT
TTGTGA
Transcript >Ophcf2|05574
ATGCCTTCTCTGATTCGTTTCCTCGCCTGCTGCGCGGGCTTATTCGGCCTGGCTGCCTCGGTCCCCTCCCGCAAG
TGCAGGGGGGGTGTCCGCCATTCGAAGCCTTCCCTTGGCATAAGCCATTCCAATCCCTCCAACAATACCAGCCGT
GCAAATGCCTCCAACAGCATAGCCGTCTACTGGGGGCAAAACTCGTACGGCCAGGGCTCCGGTCCCAACGTGCAG
CAGAACCTTGCCTACTACTGCGAGAACGCAAACATCGACGTGATCCCCCTCGCCTTCATGAACGGCATCACGCCC
CCCATCGTCAACTTTGCCAACGCGGGCGACAAGTGCAGCTCCTTCAACGGCTCAACACTCCTCCGCTGCCCCGAA
ATCGAAGCCGACATTATCAAATGCCAGGCCAAGCACAAAAAGACAATCGTTCTCTCCCTCGGCGGCGCAACCTAC
ACCCAGGGCGGCTGGGCGACGACAGCCGAGGCGGAAAAGGCCGCAGACATGGTGTGGGCCATGTTCGGACCCGTC
TCGGGAGACTATCAAGTCGATCGTCCGTTTGGCAAAGCCGTTGTTGACGGCTTCGACTTTGACTTTGAGGCTTAT
ACTAACAACCTGCCTGCTTTCGGAGCCCGGCTTCGATCCCTGATGGACGGAGCTGGCAGTAAGAAGTACGTCCTG
ACAGCGGCGCCTCAGTGCGTCTTCCCCGACGCTGCGGTGGGAACGACGCTCGATGCCGTCCCCTTTGACTACATC
TTCATCCAATTCTACAACAACTGGTGCGGCGTCTCCAACTTCCAGCCAGGAGCCCCCACCCAACAAGCCTTCAAC
TTCGACGTCTGGGACGCCTGGAGCAAGCGCAGCAAGAACCCATCCGTCAAGCTCCTTCTCGGCATCCCCGCCAAC
GTCGGTGCCGGGGGCGGATACGTGCGCGGGCCCAAGCTTGCGGCCATCATCAAGTACTGCTCCGACTTTTCGTCT
TTTGGCGGCGTCATGATGTGGGATGTGAGTCAGTTGTACGCCAATCCGGGGTTTTTGGAGGAGATTGTTGCCAGT
TTGTGA
Gene >Ophcf2|05574
ATGCCTTCTCTGATTCGTTTCCTCGCCTGCTGCGCGGGCTTATTCGGCCTGGCTGCCTCGGTCCCCTCCCGCAAG
TGCAGGGGGGGTGTCCGCCATTCGAAGCCTTCCCTTGGCATAAGCCATTCCAATCCCTCCAACAATACCAGCCGT
GCAAATGCCTCCAACAGCATAGCCGTCTACTGGGGTGAGCAGCCTCGTGCAACCGCAGAGAAACAAGACTGACGG
TCTGTTACAGGGCAAAACTCGTACGGCCAGGGCTCCGGTCCCAACGTGCAGCAGAACCTTGCCTACTACTGCGAG
AGTGAGTCGACCCGTTCTGAGCGAGGAGACATGTCCATGAAATCCTGACGAGTACATGCAATGGCCAGACGCAAA
CATCGACGTGATCCCCCTCGCCTTCATGAACGGCATCACGCCCCCCATCGTCAACTTTGCCAACGCGGGCGACAA
GTGCAGCTCCTTCAACGGCTCAACACTCCTCCGCTGCCCCGAAATCGAAGCCGACATTATCAAATGCCAGGCCAA
GCACAAAAAGACAATCGTTCTCTCCCTCGGCGGCGCAACCTACACCCAGGGCGGCTGGGCGACGACAGCCGAGGC
GGAAAAGGCCGCAGACATGGTGTGGGCCATGTTCGGACCCGTCTCGGGAGACTATCAAGTCGATCGTCCGTTTGG
CAAAGCCGTTGTTGACGGCTTCGACTTTGACTTTGAGGCTTATACTAACAACCTGCCTGCTTTCGGAGCCCGGCT
TCGATCCCTGATGGACGGAGCTGGCAGTAAGAAGTACGTCCTGACAGCGGCGCCTCAGTGCGTCTTCCCCGACGC
TGCGGTGGGAACGACGCTCGATGCCGTCCCCTTTGACTACATCTTCATCCAATTCTACAACAACTGGTGCGGCGT
CTCCAACTTCCAGCCAGGAGCCCCCACCCAACAAGCCTTCAACTTCGACGTCTGGGACGCCTGGAGCAAGCGCAG
CAAGAACCCATCCGTCAAGCTCCTTCTCGGCATCCCCGCCAACGTCGGTGCCGGGGGCGGATACGTGCGCGGGCC
CAAGCTTGCGGCCATCATCAAGTACTGCTCCGACTTTTCGTCTTTTGGCGGCGTCATGATGTGGGATGTGAGTCA
GTTGTACGCCAATCCGGGGTTTTTGGAGGAGATTGTTGCCAGTTTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail