Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05568
Gene name
Locationscaffold_06:579104..584855
Strand+
Gene length (bp)5751
Transcript length (bp)5664
Coding sequence length (bp)5664
Protein length (aa) 1888

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01369 Sec7 Sec7 domain 5.5E-70 629 812
PF20252 BIG2_C BIG2 C-terminal domain 3.8E-56 1656 1835
PF12783 Sec7_N Guanine nucleotide exchange factor in Golgi transport N-terminal 1.8E-39 304 475
PF09324 DUF1981 Domain of unknown function (DUF1981) 7.0E-31 1182 1264
PF16213 DCB Dimerisation and cyclophilin-binding domain of Mon2 4.7E-22 4 188

GO

GO Term Description Terminal node
GO:0005085 guanyl-nucleotide exchange factor activity Yes
GO:0032012 regulation of ARF protein signal transduction Yes
GO:0008150 biological_process No
GO:0050794 regulation of cellular process No
GO:0065007 biological regulation No
GO:0030234 enzyme regulator activity No
GO:1902531 regulation of intracellular signal transduction No
GO:0003674 molecular_function No
GO:0048583 regulation of response to stimulus No
GO:0050789 regulation of biological process No
GO:0060589 nucleoside-triphosphatase regulator activity No
GO:0009966 regulation of signal transduction No
GO:0046578 regulation of Ras protein signal transduction No
GO:0010646 regulation of cell communication No
GO:0098772 molecular function regulator activity No
GO:0023051 regulation of signaling No
GO:0030695 GTPase regulator activity No
GO:0051056 regulation of small GTPase mediated signal transduction No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Golgi apparatus Nuclear localization signal 0.4515 0.4937 0.0269 0.2096 0.0677 0.0104 0.3056 0.264 0.5517 0.0095

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5617
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2014
Ophiocordyceps australis map64 (Brazil) OphauB2|5514
Ophiocordyceps camponoti-floridani Ophcf2|05568 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6167
Ophiocordyceps kimflemingae Ophio5|6521
Ophiocordyceps subramaniannii Hirsu2|7606

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05568
MSSLKFVVSSLDFIAASKDAQRNKQLAESAKTALDAIKDHDADQLPDPDLVFAPLQLATKSNNAQLITAALDCIG
KLISYSFFSPHVVDDAASRAHDAAPAPPLIERAIDTICDCFQGDTTAPEIQLQIVKSLLAAVLNDKIVVHGAGLL
KAVRQVYNVFLLSRSTANQQVAQGTLTQMAGTVFERVKARIHMKESRMALRNLRHSSSNVTFDPSDVATPLGPPG
PDREDSPVPSTDANAPPDEAVKLTLKDLEHRKSFDDSALGDGPTMVSRLTPARPSPSAPDPSSQQDEDDDLLDAE
DEVYVRDAYLIFRSFCNLSTKVLAPDQLYDIRGQPMRSKLISLHLILTLLNNNMTVFTSPLCTIKNSKSNEPTSF
LQAIKFYLCLSITRNGASSVDRIFDVCCEIFWLMFKFMRQSFKKEIEVFLNEIYLALLSRRNAHLSQKLHFVAIL
NRLCADPRALVEIYLNYDCDQTVDNLFQTIIEDLSRFSTTPVAITPATEQLYEEARAKTTPATEWQLKGILPPPL
TVAHILPPQEAEPDIPKEYSMKRLSLEALVEALRSLMDWSASPGVEGGESARADVDGARTSLEEQRPSIDPTPSD
SASRSEVPLAPPTPVVDDDPEQLEKEKARKTALTNAIAQFNFKPKRGIKLLLRDGFISGDSPQDIARFLLNEDKL
DKAQIGEFLGEGDQQNIDIMHAFVDSMEFTRKRFVDALRQFLQSFRLPGEAQKIDRFMLKFAERYVMGNPNAFAN
ADTAYVLAYSVIMLNTDQHSSKIAKRMSKEEFIKNNRGINDNSDLPDDYLISIYDEIASNEIVLTSERQAAAAAA
AAAGTLGAQPTGLAAGLGHALSNVGRDLQREAYVQQSEEISLRSEQLFKNLFKSQRRSAAKAGLRFIPATSSKHV
GSMFDVTWMSFFSAFSGQMQKAHNIEVSKLCLEGMKLATKIACLFGLATPREAFISALRNTTNLNNPQEILAKNI
EALKVLLELGQTEGNLIRESWKDILMCISQLDRLQLITGGVDENAIPDVSQARFMPPPSRTETSDSRSSGNSSRQ
PRTATPRQRAGTGPRGFSHEIALESRSDELIHSVDRIFSNTANLSGEAMVHFARALTEVSWDEIKVSGSNDSPRT
YSLQKIVEISYYNMYRVRFEWTNVWDVVGEHFNQVGCHNNMNIVFFALDSLRQLSMRFLEIEELAGFKFQKDFLK
PFELVLANSHNVTVKDLVLRCLVQMIQARGDNIRSGWRTMFGVFTVAAREPHESIVAFAFENVSQVYRDKLGVVI
SQGAFTDLIVCLTEFSKNTKFQKKSLAAMELLKSIIPTMLKTPECPLSQQQQEQQQQQQQQQQQQQQQQQQQQQQ
QQQQQQQQQHPEEETAVTVDGKRTQAKTSVEEGFWFPILFAFHDVLMTGEDLEVRSNALEYFFAALIKHGGDFTP
EFWDILWRQQLYPIFMVLRSRPEMSNVLSHEELSVWLSTTMIQALRNMMTLFTHYFDALEHMLDRFLELLALCIV
QENDTIARIGSNCLQQLILKNVARFTPGHWAKIVGAFCDLFERTTAYQLFTAATMSPSSANGYDFPAADKTPADE
TPLRINGGGEENGPTPAVDGHHRRQRRPSSPGRPMTDEDLQSPSSGPALEEFRPSSNLQQQPVVVTAARRRRFNR
IISRCVLQLLMIETVNELFSNDTVYAHIPSTDLLRLMALLKRSFQFARRFNDDKELRMQLWREGFMKQPPNLLKQ
ESGSAATYVSILFRMFGDNAPERLESRPDIEAALVPLCKDIIVGYSALVEESQQRNIIAWRPVVVDVLEGYATFP
HDAFRHHLPAFYPLVVDLLAKDLGPDLRAALLVVLRRVGEVGLGIEDMARGGGEMRRESGAAVGGGELRRESIIP
DGDGEAAARRML*
Coding >Ophcf2|05568
ATGAGCTCGCTCAAGTTCGTCGTGTCCTCGCTGGACTTTATCGCCGCTTCGAAAGATGCCCAGCGGAATAAGCAG
CTGGCAGAGTCGGCCAAGACGGCCCTCGACGCCATCAAGGATCACGACGCTGACCAACTGCCCGACCCGGATCTC
GTCTTTGCGCCCCTACAGCTCGCCACAAAGTCCAATAACGCGCAGCTGATCACGGCCGCCCTCGACTGCATCGGG
AAGCTGATATCGTACTCGTTCTTCTCTCCCCACGTCGTCGACGACGCCGCCTCCCGCGCTCACGATGCCGCCCCC
GCGCCGCCTCTCATTGAGCGCGCCATCGATACCATATGCGATTGCTTTCAGGGCGACACGACGGCCCCCGAGATC
CAGCTGCAGATTGTAAAGTCGCTGTTGGCCGCCGTCCTGAATGACAAGATCGTCGTCCACGGCGCCGGCTTGCTC
AAGGCCGTGCGACAGGTTTATAACGTCTTCCTACTCTCCCGCAGCACCGCCAACCAGCAGGTCGCCCAGGGCACC
CTGACTCAGATGGCCGGCACCGTCTTTGAGCGCGTCAAGGCCAGGATCCATATGAAGGAGTCTCGTATGGCCCTG
CGCAACCTCAGACACAGCTCCAGCAACGTCACCTTCGACCCTTCCGATGTCGCCACACCCCTCGGCCCCCCTGGC
CCTGACCGCGAGGACTCGCCGGTCCCGTCGACCGATGCCAATGCGCCGCCAGACGAGGCCGTCAAGCTCACCCTC
AAGGACCTCGAGCATCGCAAGAGCTTCGACGACTCCGCCCTCGGCGACGGGCCTACCATGGTCTCCAGGCTGACG
CCCGCCCGGCCCTCCCCGTCGGCTCCCGACCCCTCGAGCCAACAAGACGAAGACGACGATCTCTTGGACGCCGAG
GACGAAGTCTACGTTCGCGACGCCTATCTCATCTTTCGCTCTTTCTGCAACCTGTCGACAAAGGTCCTCGCCCCT
GATCAGCTCTACGACATCCGCGGTCAGCCCATGCGCTCCAAGCTCATCTCCCTCCACCTCATACTCACCCTCCTC
AACAACAACATGACCGTCTTCACCTCACCCCTGTGCACCATCAAGAACTCCAAGAGCAACGAGCCCACGTCCTTT
TTGCAAGCCATCAAGTTTTATCTCTGCCTCAGCATCACGCGCAACGGCGCCAGCTCCGTCGACCGCATCTTCGAC
GTCTGCTGCGAGATATTCTGGCTCATGTTCAAATTCATGCGCCAGTCCTTCAAGAAAGAAATCGAGGTTTTTCTC
AACGAAATCTACCTGGCTCTTCTCTCCCGAAGAAACGCCCACCTGTCGCAGAAGCTTCACTTCGTCGCCATTCTC
AACCGACTCTGTGCCGATCCGCGCGCCTTGGTAGAGATTTACCTCAACTATGACTGCGATCAGACCGTCGACAAC
CTGTTCCAGACCATCATAGAGGACCTCTCCAGGTTCTCCACCACGCCCGTCGCCATCACGCCCGCGACGGAGCAG
CTCTACGAAGAGGCGCGCGCCAAGACGACGCCCGCCACCGAGTGGCAGCTTAAAGGCATCCTTCCGCCGCCGCTC
ACCGTCGCCCACATCCTTCCGCCGCAGGAGGCCGAGCCGGATATACCCAAGGAGTACTCGATGAAGCGGCTGTCT
TTGGAGGCCCTGGTCGAGGCGCTGCGATCGCTGATGGACTGGTCGGCCTCCCCGGGCGTCGAAGGGGGCGAAAGC
GCCAGAGCCGACGTCGACGGCGCCAGGACTTCGCTGGAGGAGCAGCGGCCGTCCATCGATCCCACGCCCAGCGAT
AGTGCTTCCCGTTCCGAAGTCCCGCTGGCTCCCCCGACGCCCGTGGTCGACGACGACCCGGAGCAGCTGGAGAAG
GAAAAGGCGCGCAAGACGGCGCTCACAAACGCCATCGCCCAGTTCAACTTCAAGCCCAAGAGGGGTATCAAGCTG
CTCCTGCGTGACGGCTTCATCTCGGGCGACAGCCCTCAGGACATTGCTCGCTTCCTCCTCAACGAGGACAAGCTT
GACAAGGCTCAGATTGGCGAGTTCCTGGGCGAGGGCGACCAGCAGAACATTGACATCATGCATGCTTTTGTCGAC
TCGATGGAATTCACCCGAAAGCGCTTCGTCGACGCGCTGCGCCAGTTCTTGCAGTCCTTTAGGCTGCCCGGCGAG
GCCCAGAAGATCGACCGCTTCATGCTCAAGTTCGCCGAGCGCTACGTCATGGGCAATCCAAACGCCTTCGCCAAC
GCCGATACCGCCTACGTGCTGGCCTACTCGGTCATCATGCTCAATACGGACCAGCACAGCAGCAAGATCGCCAAG
CGGATGAGCAAGGAGGAGTTTATCAAGAACAACCGCGGCATCAACGACAATTCGGATCTCCCCGACGACTACCTC
ATCAGCATCTACGACGAGATCGCAAGCAACGAGATTGTCCTTACAAGCGAGCGCCAGGCCGCCGCCGCCGCCGCC
GCCGCCGCGGGCACGCTCGGCGCTCAGCCTACGGGTCTCGCGGCCGGCCTCGGCCATGCGCTGTCCAACGTCGGG
CGCGACTTGCAGCGCGAGGCCTACGTCCAGCAGTCGGAGGAGATCTCGCTGCGGTCCGAGCAGCTGTTCAAGAAC
CTGTTCAAGAGCCAGCGGCGCAGCGCGGCCAAGGCAGGCCTCCGCTTCATCCCCGCCACCTCGTCCAAGCACGTC
GGCTCCATGTTCGACGTCACCTGGATGTCCTTCTTCTCCGCCTTCTCGGGCCAGATGCAAAAGGCGCACAATATC
GAGGTCAGCAAGCTGTGCCTCGAGGGCATGAAGCTGGCGACCAAGATTGCCTGCCTGTTCGGGCTCGCCACGCCG
CGCGAGGCCTTCATCTCGGCGCTGAGGAACACGACAAATCTCAACAACCCGCAGGAGATACTGGCCAAGAACATT
GAGGCCCTCAAGGTCCTGCTCGAGCTCGGACAGACCGAGGGTAACCTGATACGCGAGTCGTGGAAGGATATACTC
ATGTGCATCAGCCAGCTCGACCGGTTGCAGCTCATCACGGGCGGCGTCGACGAGAACGCGATCCCGGACGTATCG
CAGGCACGCTTCATGCCGCCGCCGTCGCGGACCGAGACGTCGGACTCGAGGTCGTCCGGCAATAGCTCGCGGCAA
CCGCGTACGGCGACGCCCCGGCAGAGGGCCGGCACGGGGCCCCGGGGCTTCTCGCACGAGATTGCGCTCGAGAGC
CGGTCGGACGAGCTCATCCACAGCGTCGACCGCATCTTCTCCAACACGGCCAACCTCTCGGGCGAGGCCATGGTG
CACTTCGCCCGCGCCCTGACCGAGGTGAGCTGGGACGAGATCAAGGTCTCCGGGTCCAACGACTCGCCGAGGACG
TACAGCCTGCAGAAGATTGTCGAGATCAGCTACTACAACATGTACCGCGTGCGGTTCGAGTGGACCAACGTCTGG
GACGTGGTGGGCGAGCACTTCAACCAGGTCGGCTGCCACAACAACATGAACATCGTCTTCTTCGCCCTCGACTCG
CTGCGGCAGCTGTCGATGCGTTTCCTCGAGATTGAAGAGCTGGCGGGCTTCAAGTTCCAAAAGGACTTCCTGAAG
CCGTTTGAGCTGGTGCTGGCCAACTCGCACAACGTGACGGTCAAGGACCTGGTGCTGCGCTGCTTGGTGCAGATG
ATCCAGGCCCGGGGAGATAACATCCGCTCCGGCTGGAGGACCATGTTCGGCGTCTTCACCGTGGCGGCGCGGGAG
CCTCACGAGAGCATCGTGGCGTTTGCCTTTGAAAACGTCAGCCAGGTCTACAGGGACAAGCTGGGCGTCGTGATA
TCGCAGGGCGCCTTTACCGATCTCATCGTCTGCCTGACCGAGTTTTCCAAGAACACCAAATTCCAGAAGAAGAGC
CTGGCGGCCATGGAGCTGCTCAAGTCGATTATCCCGACGATGCTCAAGACGCCCGAGTGTCCGCTGTCGCAGCAG
CAGCAGGAACAACAGCAACAGCAACAGCAACAGCAACAGCAACAGCAACAGCAACAGCAACAGCAACAGCAACAG
CAACAGCAACAGCAACAGCAACAGCAACATCCCGAAGAGGAGACGGCGGTGACTGTCGACGGCAAGCGGACGCAG
GCCAAGACGTCGGTCGAGGAGGGCTTTTGGTTCCCGATCCTGTTCGCCTTTCACGACGTGCTCATGACGGGCGAG
GATCTCGAAGTGCGGTCCAACGCGCTCGAGTACTTCTTCGCCGCCCTCATCAAGCACGGCGGCGACTTTACGCCC
GAGTTCTGGGACATTCTCTGGCGGCAGCAGCTGTATCCCATCTTCATGGTGCTCCGGTCGCGGCCCGAGATGAGC
AACGTGCTGAGCCACGAGGAGCTGTCGGTCTGGCTGTCTACGACGATGATTCAGGCGCTGCGCAACATGATGACG
CTCTTCACGCACTACTTTGACGCGCTCGAGCACATGCTGGATCGCTTCCTCGAGCTGCTGGCCCTGTGCATCGTG
CAGGAGAATGACACGATTGCGCGCATCGGCAGCAACTGTCTGCAGCAGCTGATACTCAAGAACGTGGCCAGGTTC
ACACCGGGGCACTGGGCCAAGATCGTCGGCGCCTTTTGCGATCTGTTTGAGCGCACGACGGCCTACCAGCTGTTT
ACGGCTGCCACCATGAGTCCGTCATCGGCCAACGGGTACGACTTTCCGGCGGCCGATAAGACGCCGGCGGACGAG
ACGCCGTTACGGATCAACGGTGGCGGCGAGGAGAACGGGCCGACACCGGCGGTTGACGGTCATCATCGTCGGCAG
AGACGGCCGTCGTCACCCGGAAGGCCGATGACGGACGAGGATCTGCAGAGCCCATCATCCGGTCCCGCGCTCGAG
GAGTTCAGGCCGTCGTCCAACCTTCAGCAGCAACCGGTGGTGGTCACGGCAGCACGGCGACGGCGTTTCAACCGT
ATCATCTCCCGCTGCGTCCTACAGCTCCTCATGATTGAAACGGTCAACGAGCTGTTCAGCAACGATACCGTGTAC
GCGCACATACCGTCGACGGACCTGCTACGGCTCATGGCCCTGCTCAAGCGATCCTTCCAGTTCGCGCGCCGCTTC
AACGACGACAAGGAGCTCAGAATGCAGCTCTGGCGCGAAGGCTTCATGAAGCAGCCGCCCAACCTGCTCAAGCAG
GAGAGCGGCTCTGCGGCCACGTACGTATCCATCCTGTTCCGCATGTTCGGCGACAACGCGCCCGAAAGGCTGGAG
AGCAGGCCCGACATCGAAGCGGCACTGGTGCCCCTATGCAAGGACATCATCGTCGGCTACTCTGCTCTCGTCGAG
GAGAGCCAACAGCGCAATATCATAGCCTGGAGGCCCGTCGTCGTCGACGTCCTCGAGGGCTACGCTACCTTTCCC
CACGACGCCTTCCGCCACCACTTGCCGGCTTTTTACCCGCTCGTCGTCGACCTGCTGGCCAAGGACCTGGGGCCT
GACCTTCGGGCGGCGCTGCTCGTCGTCCTCAGGCGCGTTGGTGAGGTCGGACTTGGGATCGAGGACATGGCCAGG
GGTGGGGGGGAGATGAGGAGGGAGAGCGGTGCTGCGGTGGGAGGGGGTGAGTTGAGGAGGGAGAGCATCATCCCT
GATGGCGATGGGGAGGCTGCGGCGAGGAGAATGTTGTGA
Transcript >Ophcf2|05568
ATGAGCTCGCTCAAGTTCGTCGTGTCCTCGCTGGACTTTATCGCCGCTTCGAAAGATGCCCAGCGGAATAAGCAG
CTGGCAGAGTCGGCCAAGACGGCCCTCGACGCCATCAAGGATCACGACGCTGACCAACTGCCCGACCCGGATCTC
GTCTTTGCGCCCCTACAGCTCGCCACAAAGTCCAATAACGCGCAGCTGATCACGGCCGCCCTCGACTGCATCGGG
AAGCTGATATCGTACTCGTTCTTCTCTCCCCACGTCGTCGACGACGCCGCCTCCCGCGCTCACGATGCCGCCCCC
GCGCCGCCTCTCATTGAGCGCGCCATCGATACCATATGCGATTGCTTTCAGGGCGACACGACGGCCCCCGAGATC
CAGCTGCAGATTGTAAAGTCGCTGTTGGCCGCCGTCCTGAATGACAAGATCGTCGTCCACGGCGCCGGCTTGCTC
AAGGCCGTGCGACAGGTTTATAACGTCTTCCTACTCTCCCGCAGCACCGCCAACCAGCAGGTCGCCCAGGGCACC
CTGACTCAGATGGCCGGCACCGTCTTTGAGCGCGTCAAGGCCAGGATCCATATGAAGGAGTCTCGTATGGCCCTG
CGCAACCTCAGACACAGCTCCAGCAACGTCACCTTCGACCCTTCCGATGTCGCCACACCCCTCGGCCCCCCTGGC
CCTGACCGCGAGGACTCGCCGGTCCCGTCGACCGATGCCAATGCGCCGCCAGACGAGGCCGTCAAGCTCACCCTC
AAGGACCTCGAGCATCGCAAGAGCTTCGACGACTCCGCCCTCGGCGACGGGCCTACCATGGTCTCCAGGCTGACG
CCCGCCCGGCCCTCCCCGTCGGCTCCCGACCCCTCGAGCCAACAAGACGAAGACGACGATCTCTTGGACGCCGAG
GACGAAGTCTACGTTCGCGACGCCTATCTCATCTTTCGCTCTTTCTGCAACCTGTCGACAAAGGTCCTCGCCCCT
GATCAGCTCTACGACATCCGCGGTCAGCCCATGCGCTCCAAGCTCATCTCCCTCCACCTCATACTCACCCTCCTC
AACAACAACATGACCGTCTTCACCTCACCCCTGTGCACCATCAAGAACTCCAAGAGCAACGAGCCCACGTCCTTT
TTGCAAGCCATCAAGTTTTATCTCTGCCTCAGCATCACGCGCAACGGCGCCAGCTCCGTCGACCGCATCTTCGAC
GTCTGCTGCGAGATATTCTGGCTCATGTTCAAATTCATGCGCCAGTCCTTCAAGAAAGAAATCGAGGTTTTTCTC
AACGAAATCTACCTGGCTCTTCTCTCCCGAAGAAACGCCCACCTGTCGCAGAAGCTTCACTTCGTCGCCATTCTC
AACCGACTCTGTGCCGATCCGCGCGCCTTGGTAGAGATTTACCTCAACTATGACTGCGATCAGACCGTCGACAAC
CTGTTCCAGACCATCATAGAGGACCTCTCCAGGTTCTCCACCACGCCCGTCGCCATCACGCCCGCGACGGAGCAG
CTCTACGAAGAGGCGCGCGCCAAGACGACGCCCGCCACCGAGTGGCAGCTTAAAGGCATCCTTCCGCCGCCGCTC
ACCGTCGCCCACATCCTTCCGCCGCAGGAGGCCGAGCCGGATATACCCAAGGAGTACTCGATGAAGCGGCTGTCT
TTGGAGGCCCTGGTCGAGGCGCTGCGATCGCTGATGGACTGGTCGGCCTCCCCGGGCGTCGAAGGGGGCGAAAGC
GCCAGAGCCGACGTCGACGGCGCCAGGACTTCGCTGGAGGAGCAGCGGCCGTCCATCGATCCCACGCCCAGCGAT
AGTGCTTCCCGTTCCGAAGTCCCGCTGGCTCCCCCGACGCCCGTGGTCGACGACGACCCGGAGCAGCTGGAGAAG
GAAAAGGCGCGCAAGACGGCGCTCACAAACGCCATCGCCCAGTTCAACTTCAAGCCCAAGAGGGGTATCAAGCTG
CTCCTGCGTGACGGCTTCATCTCGGGCGACAGCCCTCAGGACATTGCTCGCTTCCTCCTCAACGAGGACAAGCTT
GACAAGGCTCAGATTGGCGAGTTCCTGGGCGAGGGCGACCAGCAGAACATTGACATCATGCATGCTTTTGTCGAC
TCGATGGAATTCACCCGAAAGCGCTTCGTCGACGCGCTGCGCCAGTTCTTGCAGTCCTTTAGGCTGCCCGGCGAG
GCCCAGAAGATCGACCGCTTCATGCTCAAGTTCGCCGAGCGCTACGTCATGGGCAATCCAAACGCCTTCGCCAAC
GCCGATACCGCCTACGTGCTGGCCTACTCGGTCATCATGCTCAATACGGACCAGCACAGCAGCAAGATCGCCAAG
CGGATGAGCAAGGAGGAGTTTATCAAGAACAACCGCGGCATCAACGACAATTCGGATCTCCCCGACGACTACCTC
ATCAGCATCTACGACGAGATCGCAAGCAACGAGATTGTCCTTACAAGCGAGCGCCAGGCCGCCGCCGCCGCCGCC
GCCGCCGCGGGCACGCTCGGCGCTCAGCCTACGGGTCTCGCGGCCGGCCTCGGCCATGCGCTGTCCAACGTCGGG
CGCGACTTGCAGCGCGAGGCCTACGTCCAGCAGTCGGAGGAGATCTCGCTGCGGTCCGAGCAGCTGTTCAAGAAC
CTGTTCAAGAGCCAGCGGCGCAGCGCGGCCAAGGCAGGCCTCCGCTTCATCCCCGCCACCTCGTCCAAGCACGTC
GGCTCCATGTTCGACGTCACCTGGATGTCCTTCTTCTCCGCCTTCTCGGGCCAGATGCAAAAGGCGCACAATATC
GAGGTCAGCAAGCTGTGCCTCGAGGGCATGAAGCTGGCGACCAAGATTGCCTGCCTGTTCGGGCTCGCCACGCCG
CGCGAGGCCTTCATCTCGGCGCTGAGGAACACGACAAATCTCAACAACCCGCAGGAGATACTGGCCAAGAACATT
GAGGCCCTCAAGGTCCTGCTCGAGCTCGGACAGACCGAGGGTAACCTGATACGCGAGTCGTGGAAGGATATACTC
ATGTGCATCAGCCAGCTCGACCGGTTGCAGCTCATCACGGGCGGCGTCGACGAGAACGCGATCCCGGACGTATCG
CAGGCACGCTTCATGCCGCCGCCGTCGCGGACCGAGACGTCGGACTCGAGGTCGTCCGGCAATAGCTCGCGGCAA
CCGCGTACGGCGACGCCCCGGCAGAGGGCCGGCACGGGGCCCCGGGGCTTCTCGCACGAGATTGCGCTCGAGAGC
CGGTCGGACGAGCTCATCCACAGCGTCGACCGCATCTTCTCCAACACGGCCAACCTCTCGGGCGAGGCCATGGTG
CACTTCGCCCGCGCCCTGACCGAGGTGAGCTGGGACGAGATCAAGGTCTCCGGGTCCAACGACTCGCCGAGGACG
TACAGCCTGCAGAAGATTGTCGAGATCAGCTACTACAACATGTACCGCGTGCGGTTCGAGTGGACCAACGTCTGG
GACGTGGTGGGCGAGCACTTCAACCAGGTCGGCTGCCACAACAACATGAACATCGTCTTCTTCGCCCTCGACTCG
CTGCGGCAGCTGTCGATGCGTTTCCTCGAGATTGAAGAGCTGGCGGGCTTCAAGTTCCAAAAGGACTTCCTGAAG
CCGTTTGAGCTGGTGCTGGCCAACTCGCACAACGTGACGGTCAAGGACCTGGTGCTGCGCTGCTTGGTGCAGATG
ATCCAGGCCCGGGGAGATAACATCCGCTCCGGCTGGAGGACCATGTTCGGCGTCTTCACCGTGGCGGCGCGGGAG
CCTCACGAGAGCATCGTGGCGTTTGCCTTTGAAAACGTCAGCCAGGTCTACAGGGACAAGCTGGGCGTCGTGATA
TCGCAGGGCGCCTTTACCGATCTCATCGTCTGCCTGACCGAGTTTTCCAAGAACACCAAATTCCAGAAGAAGAGC
CTGGCGGCCATGGAGCTGCTCAAGTCGATTATCCCGACGATGCTCAAGACGCCCGAGTGTCCGCTGTCGCAGCAG
CAGCAGGAACAACAGCAACAGCAACAGCAACAGCAACAGCAACAGCAACAGCAACAGCAACAGCAACAGCAACAG
CAACAGCAACAGCAACAGCAACAGCAACATCCCGAAGAGGAGACGGCGGTGACTGTCGACGGCAAGCGGACGCAG
GCCAAGACGTCGGTCGAGGAGGGCTTTTGGTTCCCGATCCTGTTCGCCTTTCACGACGTGCTCATGACGGGCGAG
GATCTCGAAGTGCGGTCCAACGCGCTCGAGTACTTCTTCGCCGCCCTCATCAAGCACGGCGGCGACTTTACGCCC
GAGTTCTGGGACATTCTCTGGCGGCAGCAGCTGTATCCCATCTTCATGGTGCTCCGGTCGCGGCCCGAGATGAGC
AACGTGCTGAGCCACGAGGAGCTGTCGGTCTGGCTGTCTACGACGATGATTCAGGCGCTGCGCAACATGATGACG
CTCTTCACGCACTACTTTGACGCGCTCGAGCACATGCTGGATCGCTTCCTCGAGCTGCTGGCCCTGTGCATCGTG
CAGGAGAATGACACGATTGCGCGCATCGGCAGCAACTGTCTGCAGCAGCTGATACTCAAGAACGTGGCCAGGTTC
ACACCGGGGCACTGGGCCAAGATCGTCGGCGCCTTTTGCGATCTGTTTGAGCGCACGACGGCCTACCAGCTGTTT
ACGGCTGCCACCATGAGTCCGTCATCGGCCAACGGGTACGACTTTCCGGCGGCCGATAAGACGCCGGCGGACGAG
ACGCCGTTACGGATCAACGGTGGCGGCGAGGAGAACGGGCCGACACCGGCGGTTGACGGTCATCATCGTCGGCAG
AGACGGCCGTCGTCACCCGGAAGGCCGATGACGGACGAGGATCTGCAGAGCCCATCATCCGGTCCCGCGCTCGAG
GAGTTCAGGCCGTCGTCCAACCTTCAGCAGCAACCGGTGGTGGTCACGGCAGCACGGCGACGGCGTTTCAACCGT
ATCATCTCCCGCTGCGTCCTACAGCTCCTCATGATTGAAACGGTCAACGAGCTGTTCAGCAACGATACCGTGTAC
GCGCACATACCGTCGACGGACCTGCTACGGCTCATGGCCCTGCTCAAGCGATCCTTCCAGTTCGCGCGCCGCTTC
AACGACGACAAGGAGCTCAGAATGCAGCTCTGGCGCGAAGGCTTCATGAAGCAGCCGCCCAACCTGCTCAAGCAG
GAGAGCGGCTCTGCGGCCACGTACGTATCCATCCTGTTCCGCATGTTCGGCGACAACGCGCCCGAAAGGCTGGAG
AGCAGGCCCGACATCGAAGCGGCACTGGTGCCCCTATGCAAGGACATCATCGTCGGCTACTCTGCTCTCGTCGAG
GAGAGCCAACAGCGCAATATCATAGCCTGGAGGCCCGTCGTCGTCGACGTCCTCGAGGGCTACGCTACCTTTCCC
CACGACGCCTTCCGCCACCACTTGCCGGCTTTTTACCCGCTCGTCGTCGACCTGCTGGCCAAGGACCTGGGGCCT
GACCTTCGGGCGGCGCTGCTCGTCGTCCTCAGGCGCGTTGGTGAGGTCGGACTTGGGATCGAGGACATGGCCAGG
GGTGGGGGGGAGATGAGGAGGGAGAGCGGTGCTGCGGTGGGAGGGGGTGAGTTGAGGAGGGAGAGCATCATCCCT
GATGGCGATGGGGAGGCTGCGGCGAGGAGAATGTTGTGA
Gene >Ophcf2|05568
ATGAGCTCGCTCAAGTTCGTCGTGTCCTCGCTGGACTTTATCGCCGCTTCGAAAGATGCCCAGCGGAATAAGCAG
CTGGCAGAGTCGGCCAAGACGGCCCTCGACGCCATCAAGGATCACGACGCTGACCAACTGCCCGACCCGGATCTC
GTCTTTGCGCCCCTACAGCTCGCCACAAAGTCCAATAACGCGCAGCTGATCACGGCCGCCCTCGACTGCATCGGG
AAGCTGATATCGTACTCGTTCTTCTCTCCCCACGTCGTCGACGACGCCGCCTCCCGCGCTCACGATGCCGCCCCC
GCGCCGCCTCTCATTGAGCGCGCCATCGATACCATATGCGATTGCTTTCAGGGCGACACGACGGCCCCCGAGATC
CAGCTGCAGATTGTAAAGTCGCTGTTGGCCGCCGTCCTGAATGACAAGATCGTCGTCCACGGCGCCGGCTTGCTC
AAGGCCGTGCGACAGGTTTATAACGTCTTCCTACTCTCCCGCAGCACCGCCAACCAGCAGGTCGCCCAGGGCACC
CTGACTCAGATGGCCGGCACCGTCTTTGAGCGCGTCAAGGCCAGGATCCATATGAAGGAGTCTCGTATGGCCCTG
CGCAACCTCAGACACAGCTCCAGCAACGTCACCTTCGACCCTTCCGATGTCGCCACACCCCTCGGCCCCCCTGGC
CCTGACCGCGAGGACTCGCCGGTCCCGTCGACCGATGCCAATGCGCCGCCAGACGAGGCCGTCAAGCTCACCCTC
AAGGACCTCGAGCATCGCAAGAGCTTCGACGACTCCGCCCTCGGCGACGGGCCTACCATGGTCTCCAGGCTGACG
CCCGCCCGGCCCTCCCCGTCGGCTCCCGACCCCTCGAGCCAACAAGACGAAGACGACGATCTCTTGGACGCCGAG
GACGAAGTCTACGTTCGCGACGCCTATCTCATCTTTCGCTCTTTCTGCAACCTGTCGACAAAGGTCCTCGCCCCT
GATCAGCTCTACGACATCCGCGGTCAGCCCATGCGCTCCAAGCTCATCTCCCTCCACCTCATACTCACCCTCCTC
AACAACAACATGACCGTCTTCACCTCACCCCTGTGCACCATCAAGAACTCCAAGAGCAACGAGCCCACGTCCTTT
TTGCAAGCCATCAAGTTTTATCTCTGCCTCAGCATCACGCGCAACGGCGCCAGCTCCGTCGACCGCATCTTCGAC
GTCTGCTGCGAGATATTCTGGCTCATGTTCAAATTCATGCGCCAGTCCTTCAAGGCGAGTCGACTCGATGGGAAT
GGGAAAGGGGGGCGCCAAGGTCGAGCCGGCCCTGGCGAAGGAGGTGTGTGCTGACCGTGGCTGCAGAAAGAAATC
GAGGTTTTTCTCAACGAAATCTACCTGGCTCTTCTCTCCCGAAGAAACGCCCACCTGTCGCAGAAGCTTCACTTC
GTCGCCATTCTCAACCGACTCTGTGCCGATCCGCGCGCCTTGGTAGAGATTTACCTCAACTATGACTGCGATCAG
ACCGTCGACAACCTGTTCCAGACCATCATAGAGGACCTCTCCAGGTTCTCCACCACGCCCGTCGCCATCACGCCC
GCGACGGAGCAGCTCTACGAAGAGGCGCGCGCCAAGACGACGCCCGCCACCGAGTGGCAGCTTAAAGGCATCCTT
CCGCCGCCGCTCACCGTCGCCCACATCCTTCCGCCGCAGGAGGCCGAGCCGGATATACCCAAGGAGTACTCGATG
AAGCGGCTGTCTTTGGAGGCCCTGGTCGAGGCGCTGCGATCGCTGATGGACTGGTCGGCCTCCCCGGGCGTCGAA
GGGGGCGAAAGCGCCAGAGCCGACGTCGACGGCGCCAGGACTTCGCTGGAGGAGCAGCGGCCGTCCATCGATCCC
ACGCCCAGCGATAGTGCTTCCCGTTCCGAAGTCCCGCTGGCTCCCCCGACGCCCGTGGTCGACGACGACCCGGAG
CAGCTGGAGAAGGAAAAGGCGCGCAAGACGGCGCTCACAAACGCCATCGCCCAGTTCAACTTCAAGCCCAAGAGG
GGTATCAAGCTGCTCCTGCGTGACGGCTTCATCTCGGGCGACAGCCCTCAGGACATTGCTCGCTTCCTCCTCAAC
GAGGACAAGCTTGACAAGGCTCAGATTGGCGAGTTCCTGGGCGAGGGCGACCAGCAGAACATTGACATCATGCAT
GCTTTTGTCGACTCGATGGAATTCACCCGAAAGCGCTTCGTCGACGCGCTGCGCCAGTTCTTGCAGTCCTTTAGG
CTGCCCGGCGAGGCCCAGAAGATCGACCGCTTCATGCTCAAGTTCGCCGAGCGCTACGTCATGGGCAATCCAAAC
GCCTTCGCCAACGCCGATACCGCCTACGTGCTGGCCTACTCGGTCATCATGCTCAATACGGACCAGCACAGCAGC
AAGATCGCCAAGCGGATGAGCAAGGAGGAGTTTATCAAGAACAACCGCGGCATCAACGACAATTCGGATCTCCCC
GACGACTACCTCATCAGCATCTACGACGAGATCGCAAGCAACGAGATTGTCCTTACAAGCGAGCGCCAGGCCGCC
GCCGCCGCCGCCGCCGCCGCGGGCACGCTCGGCGCTCAGCCTACGGGTCTCGCGGCCGGCCTCGGCCATGCGCTG
TCCAACGTCGGGCGCGACTTGCAGCGCGAGGCCTACGTCCAGCAGTCGGAGGAGATCTCGCTGCGGTCCGAGCAG
CTGTTCAAGAACCTGTTCAAGAGCCAGCGGCGCAGCGCGGCCAAGGCAGGCCTCCGCTTCATCCCCGCCACCTCG
TCCAAGCACGTCGGCTCCATGTTCGACGTCACCTGGATGTCCTTCTTCTCCGCCTTCTCGGGCCAGATGCAAAAG
GCGCACAATATCGAGGTCAGCAAGCTGTGCCTCGAGGGCATGAAGCTGGCGACCAAGATTGCCTGCCTGTTCGGG
CTCGCCACGCCGCGCGAGGCCTTCATCTCGGCGCTGAGGAACACGACAAATCTCAACAACCCGCAGGAGATACTG
GCCAAGAACATTGAGGCCCTCAAGGTCCTGCTCGAGCTCGGACAGACCGAGGGTAACCTGATACGCGAGTCGTGG
AAGGATATACTCATGTGCATCAGCCAGCTCGACCGGTTGCAGCTCATCACGGGCGGCGTCGACGAGAACGCGATC
CCGGACGTATCGCAGGCACGCTTCATGCCGCCGCCGTCGCGGACCGAGACGTCGGACTCGAGGTCGTCCGGCAAT
AGCTCGCGGCAACCGCGTACGGCGACGCCCCGGCAGAGGGCCGGCACGGGGCCCCGGGGCTTCTCGCACGAGATT
GCGCTCGAGAGCCGGTCGGACGAGCTCATCCACAGCGTCGACCGCATCTTCTCCAACACGGCCAACCTCTCGGGC
GAGGCCATGGTGCACTTCGCCCGCGCCCTGACCGAGGTGAGCTGGGACGAGATCAAGGTCTCCGGGTCCAACGAC
TCGCCGAGGACGTACAGCCTGCAGAAGATTGTCGAGATCAGCTACTACAACATGTACCGCGTGCGGTTCGAGTGG
ACCAACGTCTGGGACGTGGTGGGCGAGCACTTCAACCAGGTCGGCTGCCACAACAACATGAACATCGTCTTCTTC
GCCCTCGACTCGCTGCGGCAGCTGTCGATGCGTTTCCTCGAGATTGAAGAGCTGGCGGGCTTCAAGTTCCAAAAG
GACTTCCTGAAGCCGTTTGAGCTGGTGCTGGCCAACTCGCACAACGTGACGGTCAAGGACCTGGTGCTGCGCTGC
TTGGTGCAGATGATCCAGGCCCGGGGAGATAACATCCGCTCCGGCTGGAGGACCATGTTCGGCGTCTTCACCGTG
GCGGCGCGGGAGCCTCACGAGAGCATCGTGGCGTTTGCCTTTGAAAACGTCAGCCAGGTCTACAGGGACAAGCTG
GGCGTCGTGATATCGCAGGGCGCCTTTACCGATCTCATCGTCTGCCTGACCGAGTTTTCCAAGAACACCAAATTC
CAGAAGAAGAGCCTGGCGGCCATGGAGCTGCTCAAGTCGATTATCCCGACGATGCTCAAGACGCCCGAGTGTCCG
CTGTCGCAGCAGCAGCAGGAACAACAGCAACAGCAACAGCAACAGCAACAGCAACAGCAACAGCAACAGCAACAG
CAACAGCAACAGCAACAGCAACAGCAACAGCAACAGCAACATCCCGAAGAGGAGACGGCGGTGACTGTCGACGGC
AAGCGGACGCAGGCCAAGACGTCGGTCGAGGAGGGCTTTTGGTTCCCGATCCTGTTCGCCTTTCACGACGTGCTC
ATGACGGGCGAGGATCTCGAAGTGCGGTCCAACGCGCTCGAGTACTTCTTCGCCGCCCTCATCAAGCACGGCGGC
GACTTTACGCCCGAGTTCTGGGACATTCTCTGGCGGCAGCAGCTGTATCCCATCTTCATGGTGCTCCGGTCGCGG
CCCGAGATGAGCAACGTGCTGAGCCACGAGGAGCTGTCGGTCTGGCTGTCTACGACGATGATTCAGGCGCTGCGC
AACATGATGACGCTCTTCACGCACTACTTTGACGCGCTCGAGCACATGCTGGATCGCTTCCTCGAGCTGCTGGCC
CTGTGCATCGTGCAGGAGAATGACACGATTGCGCGCATCGGCAGCAACTGTCTGCAGCAGCTGATACTCAAGAAC
GTGGCCAGGTTCACACCGGGGCACTGGGCCAAGATCGTCGGCGCCTTTTGCGATCTGTTTGAGCGCACGACGGCC
TACCAGCTGTTTACGGCTGCCACCATGAGTCCGTCATCGGCCAACGGGTACGACTTTCCGGCGGCCGATAAGACG
CCGGCGGACGAGACGCCGTTACGGATCAACGGTGGCGGCGAGGAGAACGGGCCGACACCGGCGGTTGACGGTCAT
CATCGTCGGCAGAGACGGCCGTCGTCACCCGGAAGGCCGATGACGGACGAGGATCTGCAGAGCCCATCATCCGGT
CCCGCGCTCGAGGAGTTCAGGCCGTCGTCCAACCTTCAGCAGCAACCGGTGGTGGTCACGGCAGCACGGCGACGG
CGTTTCAACCGTATCATCTCCCGCTGCGTCCTACAGCTCCTCATGATTGAAACGGTCAACGAGCTGTTCAGCAAC
GATACCGTGTACGCGCACATACCGTCGACGGACCTGCTACGGCTCATGGCCCTGCTCAAGCGATCCTTCCAGTTC
GCGCGCCGCTTCAACGACGACAAGGAGCTCAGAATGCAGCTCTGGCGCGAAGGCTTCATGAAGCAGCCGCCCAAC
CTGCTCAAGCAGGAGAGCGGCTCTGCGGCCACGTACGTATCCATCCTGTTCCGCATGTTCGGCGACAACGCGCCC
GAAAGGCTGGAGAGCAGGCCCGACATCGAAGCGGCACTGGTGCCCCTATGCAAGGACATCATCGTCGGCTACTCT
GCTCTCGTCGAGGAGAGCCAACAGCGCAATATCATAGCCTGGAGGCCCGTCGTCGTCGACGTCCTCGAGGGCTAC
GCTACCTTTCCCCACGACGCCTTCCGCCACCACTTGCCGGCTTTTTACCCGCTCGTCGTCGACCTGCTGGCCAAG
GACCTGGGGCCTGACCTTCGGGCGGCGCTGCTCGTCGTCCTCAGGCGCGTTGGTGAGGTCGGACTTGGGATCGAG
GACATGGCCAGGGGTGGGGGGGAGATGAGGAGGGAGAGCGGTGCTGCGGTGGGAGGGGGTGAGTTGAGGAGGGAG
AGCATCATCCCTGATGGCGATGGGGAGGCTGCGGCGAGGAGAATGTTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail