Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05565
Gene name
Locationscaffold_06:572677..573688
Strand+
Gene length (bp)1011
Transcript length (bp)1011
Coding sequence length (bp)1011
Protein length (aa) 337

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0796 0.0864 0.9404 0.0646 0.0334 0.0054 0.1074 0.1215 0.0907 0.0019

SignalP

SignalP signal predicted Location Score
Yes 1 - 21 0.988228

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5300
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2018
Ophiocordyceps australis map64 (Brazil) OphauB2|5519
Ophiocordyceps camponoti-floridani Ophcf2|05565 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4944
Ophiocordyceps kimflemingae Ophio5|4446
Ophiocordyceps subramaniannii Hirsu2|4791

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05565
MVNIKTSLSTVLVAAAIGVVAHPSGHGHAHRHFHRAITQYTKSVPPANDVAEKSYQAPPSPKEDLIPASPPAVPA
QVKDLLSDALPAQPAHQSQPAGQAHQGGSTGTDDLEGTFCSGSKSKRASLADVALAGNLGGSGANYGCNLKLVDS
DVGPKYKYSVRFDNAGDNKQACVCWLKIGPDGKSVNGFFKGKEVLSFNIPPRGQQYLAIQEDSKGGCSCYKDELP
VTPFGQYAGTWLEFDMASKANGGCSGADASSLVAHQYGMTVQGLQVCEASNLEEDSCSIIYAGGKGNRLSYPGGT
ENADGLSVNLQAGPAHYIATVDFKGPAPANAVNPTR*
Coding >Ophcf2|05565
ATGGTTAACATCAAGACTTCACTCTCAACCGTCCTCGTGGCCGCGGCCATCGGAGTCGTCGCCCACCCAAGCGGC
CACGGACACGCCCATCGCCACTTCCACCGCGCCATCACTCAATACACCAAGTCGGTGCCCCCGGCCAACGACGTG
GCCGAGAAGAGCTACCAGGCTCCGCCCTCTCCCAAGGAGGATCTCATCCCCGCCTCGCCCCCCGCCGTCCCGGCT
CAGGTCAAGGATCTGCTGTCCGACGCTCTGCCGGCCCAGCCCGCGCACCAGTCGCAGCCCGCTGGCCAGGCCCAC
CAAGGTGGCAGCACCGGCACTGACGACCTTGAAGGGACCTTTTGCTCCGGTTCCAAGTCGAAGCGGGCATCCCTT
GCGGACGTCGCGCTCGCGGGCAACCTCGGAGGCTCGGGCGCCAACTACGGCTGCAACCTGAAGCTGGTCGACAGC
GACGTTGGCCCCAAGTACAAGTACTCGGTCCGCTTCGACAACGCCGGCGACAACAAGCAGGCCTGCGTGTGCTGG
CTCAAGATTGGCCCCGACGGAAAGTCGGTCAACGGTTTCTTCAAGGGCAAAGAGGTGCTCAGTTTCAACATCCCG
CCCAGGGGTCAGCAGTACCTTGCCATCCAGGAGGACTCCAAAGGCGGCTGCTCCTGCTACAAGGATGAGTTGCCC
GTCACCCCCTTTGGCCAGTACGCCGGCACATGGCTCGAGTTCGACATGGCAAGCAAGGCCAACGGCGGCTGCTCG
GGCGCCGACGCCTCGTCCCTGGTCGCTCACCAGTATGGCATGACCGTTCAAGGCCTGCAGGTGTGCGAGGCGAGT
AACCTCGAGGAGGATTCGTGCTCCATCATCTACGCAGGCGGAAAGGGCAACAGGCTGTCTTACCCCGGCGGCACC
GAGAACGCCGACGGCCTCAGCGTCAACCTGCAAGCCGGCCCGGCTCACTACATCGCCACGGTCGACTTCAAGGGG
CCGGCTCCGGCGAACGCTGTGAACCCTACGCGGTGA
Transcript >Ophcf2|05565
ATGGTTAACATCAAGACTTCACTCTCAACCGTCCTCGTGGCCGCGGCCATCGGAGTCGTCGCCCACCCAAGCGGC
CACGGACACGCCCATCGCCACTTCCACCGCGCCATCACTCAATACACCAAGTCGGTGCCCCCGGCCAACGACGTG
GCCGAGAAGAGCTACCAGGCTCCGCCCTCTCCCAAGGAGGATCTCATCCCCGCCTCGCCCCCCGCCGTCCCGGCT
CAGGTCAAGGATCTGCTGTCCGACGCTCTGCCGGCCCAGCCCGCGCACCAGTCGCAGCCCGCTGGCCAGGCCCAC
CAAGGTGGCAGCACCGGCACTGACGACCTTGAAGGGACCTTTTGCTCCGGTTCCAAGTCGAAGCGGGCATCCCTT
GCGGACGTCGCGCTCGCGGGCAACCTCGGAGGCTCGGGCGCCAACTACGGCTGCAACCTGAAGCTGGTCGACAGC
GACGTTGGCCCCAAGTACAAGTACTCGGTCCGCTTCGACAACGCCGGCGACAACAAGCAGGCCTGCGTGTGCTGG
CTCAAGATTGGCCCCGACGGAAAGTCGGTCAACGGTTTCTTCAAGGGCAAAGAGGTGCTCAGTTTCAACATCCCG
CCCAGGGGTCAGCAGTACCTTGCCATCCAGGAGGACTCCAAAGGCGGCTGCTCCTGCTACAAGGATGAGTTGCCC
GTCACCCCCTTTGGCCAGTACGCCGGCACATGGCTCGAGTTCGACATGGCAAGCAAGGCCAACGGCGGCTGCTCG
GGCGCCGACGCCTCGTCCCTGGTCGCTCACCAGTATGGCATGACCGTTCAAGGCCTGCAGGTGTGCGAGGCGAGT
AACCTCGAGGAGGATTCGTGCTCCATCATCTACGCAGGCGGAAAGGGCAACAGGCTGTCTTACCCCGGCGGCACC
GAGAACGCCGACGGCCTCAGCGTCAACCTGCAAGCCGGCCCGGCTCACTACATCGCCACGGTCGACTTCAAGGGG
CCGGCTCCGGCGAACGCTGTGAACCCTACGCGGTGA
Gene >Ophcf2|05565
ATGGTTAACATCAAGACTTCACTCTCAACCGTCCTCGTGGCCGCGGCCATCGGAGTCGTCGCCCACCCAAGCGGC
CACGGACACGCCCATCGCCACTTCCACCGCGCCATCACTCAATACACCAAGTCGGTGCCCCCGGCCAACGACGTG
GCCGAGAAGAGCTACCAGGCTCCGCCCTCTCCCAAGGAGGATCTCATCCCCGCCTCGCCCCCCGCCGTCCCGGCT
CAGGTCAAGGATCTGCTGTCCGACGCTCTGCCGGCCCAGCCCGCGCACCAGTCGCAGCCCGCTGGCCAGGCCCAC
CAAGGTGGCAGCACCGGCACTGACGACCTTGAAGGGACCTTTTGCTCCGGTTCCAAGTCGAAGCGGGCATCCCTT
GCGGACGTCGCGCTCGCGGGCAACCTCGGAGGCTCGGGCGCCAACTACGGCTGCAACCTGAAGCTGGTCGACAGC
GACGTTGGCCCCAAGTACAAGTACTCGGTCCGCTTCGACAACGCCGGCGACAACAAGCAGGCCTGCGTGTGCTGG
CTCAAGATTGGCCCCGACGGAAAGTCGGTCAACGGTTTCTTCAAGGGCAAAGAGGTGCTCAGTTTCAACATCCCG
CCCAGGGGTCAGCAGTACCTTGCCATCCAGGAGGACTCCAAAGGCGGCTGCTCCTGCTACAAGGATGAGTTGCCC
GTCACCCCCTTTGGCCAGTACGCCGGCACATGGCTCGAGTTCGACATGGCAAGCAAGGCCAACGGCGGCTGCTCG
GGCGCCGACGCCTCGTCCCTGGTCGCTCACCAGTATGGCATGACCGTTCAAGGCCTGCAGGTGTGCGAGGCGAGT
AACCTCGAGGAGGATTCGTGCTCCATCATCTACGCAGGCGGAAAGGGCAACAGGCTGTCTTACCCCGGCGGCACC
GAGAACGCCGACGGCCTCAGCGTCAACCTGCAAGCCGGCCCGGCTCACTACATCGCCACGGTCGACTTCAAGGGG
CCGGCTCCGGCGAACGCTGTGAACCCTACGCGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail