Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05561
Gene name
Locationscaffold_06:560215..562218
Strand-
Gene length (bp)2003
Transcript length (bp)1890
Coding sequence length (bp)1890
Protein length (aa) 630

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00749 tRNA-synt_1c tRNA synthetases class I (E and Q), catalytic domain 3.0E-102 90 401
PF03950 tRNA-synt_1c_C tRNA synthetases class I (E and Q), anti-codon binding domain 1.0E-27 405 569

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0005737 cytoplasm Yes
GO:0043039 tRNA aminoacylation Yes
GO:0000166 nucleotide binding Yes
GO:0006418 tRNA aminoacylation for protein translation Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0046483 heterocycle metabolic process No
GO:0043168 anion binding No
GO:0140098 catalytic activity, acting on RNA No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0043170 macromolecule metabolic process No
GO:0006520 cellular amino acid metabolic process No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0019752 carboxylic acid metabolic process No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0009987 cellular process No
GO:0043436 oxoacid metabolic process No
GO:0006399 tRNA metabolic process No
GO:0110165 cellular anatomical entity No
GO:0044237 cellular metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0090304 nucleic acid metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0006082 organic acid metabolic process No
GO:0036094 small molecule binding No
GO:0032555 purine ribonucleotide binding No
GO:0043038 amino acid activation No
GO:0003824 catalytic activity No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No
GO:0016070 RNA metabolic process No
GO:0016874 ligase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0005575 cellular_component No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0044281 small molecule metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.7689 0.3623 0.4805 0.076 0.1205 0.0094 0.2961 0.0084 0.0665 0.0026

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5591
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3279
Ophiocordyceps australis map64 (Brazil) OphauB2|5523
Ophiocordyceps camponoti-floridani Ophcf2|05561 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4948
Ophiocordyceps kimflemingae Ophio5|4451
Ophiocordyceps subramaniannii Hirsu2|7506

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05561
MADDVSQPMAKLQLDEETGEMVSKSELKKRQQKRAKKAAQEKARQEKAAAEPTTRAAAPAQKPEETPMDPDAMFK
QGFLDDVYKERPSDKVVTRFPPEPNGYLHIGHAKAIAVNFGFARHHGGVCYLRYDDTNPEKEEEQYFTAIKDVVQ
WLGFEPFKVTYSSDNFAKLYAMAEKLVMLGKAYVCACTDVELKDQRGGEKGSHPRYRCQHAEQSVDDNLTKFRAM
RDGKYKPKEVFLRMKQDIVDNNPQMWDLAAYRIKTDTPHHRTGRDWVIYPTYDFAHCLCDSFEGITHSLCTTEFI
LSRVSYEWLNKTLEVYEPMQREYGRLNLTGTVLSKRKIIKLIEEKIVRSWDDPRLYTLMAIRRRGVPPGAILEFV
NELGVTTNITAIQIKRFEQSVRKYLEKTVPRLMMILDPVPLVIDDAEALDLDLPFSPKDPKMGSHTVKFTPTVYI
DREDFREVDSKDYFRLAPGKTVGLLNVPFPVKAVSFSKDPTTGKVTEIRGVFDKEAKKPKTYIQWVGTEGTRKVE
ARIHNPLFKSEKPNDAEGGYLNDVNPDSEVIYPEAVIESGFDEVRRRAPWPEAAGESELGRGGPESVRFQAMRVA
YFAMDSDSSDDKIVLNRIVSLKEDAGKRL*
Coding >Ophcf2|05561
ATGGCCGATGACGTCTCTCAGCCCATGGCCAAGCTCCAACTCGACGAGGAGACTGGCGAGATGGTCTCCAAGTCG
GAGCTGAAGAAGCGGCAGCAGAAACGAGCCAAGAAAGCAGCCCAAGAAAAGGCACGACAAGAAAAGGCAGCTGCA
GAGCCGACGACTCGGGCTGCTGCGCCGGCGCAAAAACCAGAAGAGACGCCCATGGACCCAGACGCCATGTTCAAG
CAGGGCTTCCTCGACGACGTATACAAGGAGCGTCCGTCCGACAAGGTCGTGACCAGATTCCCGCCTGAGCCCAAC
GGCTATCTTCACATTGGCCACGCCAAGGCAATCGCTGTGAACTTTGGATTCGCCAGGCATCACGGCGGCGTGTGC
TATCTGCGCTACGACGACACCAATCCGGAGAAGGAAGAGGAGCAGTACTTTACCGCCATCAAGGACGTGGTGCAG
TGGCTCGGGTTCGAACCATTCAAGGTCACCTACTCGAGTGACAACTTTGCGAAGCTCTACGCCATGGCCGAGAAG
CTGGTGATGCTGGGAAAGGCTTACGTCTGCGCCTGCACCGACGTCGAGCTCAAGGACCAACGGGGAGGCGAAAAG
GGCTCGCATCCCCGCTACCGCTGTCAACACGCCGAGCAGTCCGTCGATGACAATCTGACCAAGTTTCGAGCCATG
CGAGACGGCAAGTACAAGCCCAAGGAGGTGTTTCTGCGCATGAAGCAGGACATTGTCGACAATAACCCCCAGATG
TGGGACCTGGCCGCCTATCGAATCAAGACGGACACCCCCCATCACCGTACGGGCCGAGACTGGGTCATCTATCCG
ACGTACGACTTTGCCCACTGCCTATGCGACAGCTTCGAGGGCATCACGCATTCGCTCTGCACGACCGAGTTCATC
CTGAGCCGAGTTTCATACGAATGGCTCAACAAGACGCTCGAGGTTTACGAGCCGATGCAGAGGGAATACGGCCGG
CTCAACCTGACGGGCACCGTCCTCTCCAAGAGAAAGATTATCAAGCTCATCGAGGAAAAGATTGTACGCAGCTGG
GACGATCCCAGACTGTACACGCTCATGGCCATCCGACGGCGCGGCGTGCCTCCAGGCGCCATTCTCGAATTCGTC
AACGAGCTGGGTGTCACCACCAACATCACGGCGATCCAGATCAAGCGGTTCGAGCAGAGCGTGCGCAAGTACCTG
GAGAAGACGGTGCCCCGGCTGATGATGATACTCGACCCCGTGCCGTTGGTGATTGACGACGCCGAGGCGCTGGAT
CTCGACCTGCCCTTTTCCCCCAAAGACCCCAAGATGGGCTCGCATACCGTCAAGTTTACGCCGACCGTCTACATT
GACAGGGAGGATTTCAGAGAGGTGGATAGCAAGGACTACTTCCGCCTCGCCCCCGGCAAGACGGTTGGCCTCCTC
AATGTGCCTTTTCCGGTCAAGGCCGTCTCCTTCAGCAAGGACCCGACGACGGGCAAAGTGACGGAGATTCGCGGC
GTCTTTGACAAGGAGGCCAAGAAGCCCAAGACGTACATTCAATGGGTCGGGACCGAGGGTACGAGAAAGGTCGAA
GCTCGCATCCACAACCCGCTCTTCAAGTCGGAGAAGCCCAACGACGCCGAGGGCGGGTACCTCAACGACGTCAAT
CCGGACAGCGAGGTCATATATCCCGAGGCCGTGATCGAGTCGGGCTTTGATGAGGTTAGGAGGCGCGCGCCGTGG
CCAGAGGCGGCTGGCGAGAGCGAGCTCGGGAGGGGAGGGCCTGAGAGTGTGAGGTTCCAGGCGATGCGGGTTGCG
TACTTTGCTATGGATTCGGACAGCTCAGATGACAAGATTGTGCTGAACCGTATCGTGAGCTTGAAGGAGGACGCG
GGCAAAAGGCTGTGA
Transcript >Ophcf2|05561
ATGGCCGATGACGTCTCTCAGCCCATGGCCAAGCTCCAACTCGACGAGGAGACTGGCGAGATGGTCTCCAAGTCG
GAGCTGAAGAAGCGGCAGCAGAAACGAGCCAAGAAAGCAGCCCAAGAAAAGGCACGACAAGAAAAGGCAGCTGCA
GAGCCGACGACTCGGGCTGCTGCGCCGGCGCAAAAACCAGAAGAGACGCCCATGGACCCAGACGCCATGTTCAAG
CAGGGCTTCCTCGACGACGTATACAAGGAGCGTCCGTCCGACAAGGTCGTGACCAGATTCCCGCCTGAGCCCAAC
GGCTATCTTCACATTGGCCACGCCAAGGCAATCGCTGTGAACTTTGGATTCGCCAGGCATCACGGCGGCGTGTGC
TATCTGCGCTACGACGACACCAATCCGGAGAAGGAAGAGGAGCAGTACTTTACCGCCATCAAGGACGTGGTGCAG
TGGCTCGGGTTCGAACCATTCAAGGTCACCTACTCGAGTGACAACTTTGCGAAGCTCTACGCCATGGCCGAGAAG
CTGGTGATGCTGGGAAAGGCTTACGTCTGCGCCTGCACCGACGTCGAGCTCAAGGACCAACGGGGAGGCGAAAAG
GGCTCGCATCCCCGCTACCGCTGTCAACACGCCGAGCAGTCCGTCGATGACAATCTGACCAAGTTTCGAGCCATG
CGAGACGGCAAGTACAAGCCCAAGGAGGTGTTTCTGCGCATGAAGCAGGACATTGTCGACAATAACCCCCAGATG
TGGGACCTGGCCGCCTATCGAATCAAGACGGACACCCCCCATCACCGTACGGGCCGAGACTGGGTCATCTATCCG
ACGTACGACTTTGCCCACTGCCTATGCGACAGCTTCGAGGGCATCACGCATTCGCTCTGCACGACCGAGTTCATC
CTGAGCCGAGTTTCATACGAATGGCTCAACAAGACGCTCGAGGTTTACGAGCCGATGCAGAGGGAATACGGCCGG
CTCAACCTGACGGGCACCGTCCTCTCCAAGAGAAAGATTATCAAGCTCATCGAGGAAAAGATTGTACGCAGCTGG
GACGATCCCAGACTGTACACGCTCATGGCCATCCGACGGCGCGGCGTGCCTCCAGGCGCCATTCTCGAATTCGTC
AACGAGCTGGGTGTCACCACCAACATCACGGCGATCCAGATCAAGCGGTTCGAGCAGAGCGTGCGCAAGTACCTG
GAGAAGACGGTGCCCCGGCTGATGATGATACTCGACCCCGTGCCGTTGGTGATTGACGACGCCGAGGCGCTGGAT
CTCGACCTGCCCTTTTCCCCCAAAGACCCCAAGATGGGCTCGCATACCGTCAAGTTTACGCCGACCGTCTACATT
GACAGGGAGGATTTCAGAGAGGTGGATAGCAAGGACTACTTCCGCCTCGCCCCCGGCAAGACGGTTGGCCTCCTC
AATGTGCCTTTTCCGGTCAAGGCCGTCTCCTTCAGCAAGGACCCGACGACGGGCAAAGTGACGGAGATTCGCGGC
GTCTTTGACAAGGAGGCCAAGAAGCCCAAGACGTACATTCAATGGGTCGGGACCGAGGGTACGAGAAAGGTCGAA
GCTCGCATCCACAACCCGCTCTTCAAGTCGGAGAAGCCCAACGACGCCGAGGGCGGGTACCTCAACGACGTCAAT
CCGGACAGCGAGGTCATATATCCCGAGGCCGTGATCGAGTCGGGCTTTGATGAGGTTAGGAGGCGCGCGCCGTGG
CCAGAGGCGGCTGGCGAGAGCGAGCTCGGGAGGGGAGGGCCTGAGAGTGTGAGGTTCCAGGCGATGCGGGTTGCG
TACTTTGCTATGGATTCGGACAGCTCAGATGACAAGATTGTGCTGAACCGTATCGTGAGCTTGAAGGAGGACGCG
GGCAAAAGGCTGTGA
Gene >Ophcf2|05561
ATGGCCGATGACGTCTCTCAGCCCATGGCCAAGCTCCAACTCGACGAGGAGACTGGCGAGATGGTCTCCAAGTCG
GAGCTGAAGAAGCGGCAGCAGAAACGAGCCAAGAAAGCAGCCCAAGAAAAGGCACGACAAGAAAAGGCAGCTGCA
GAGCCGACGACTCGGGCTGCTGCGCCGGCGCAAAAACCAGAAGAGACGCCCATGGACCCAGACGCCATGTTCAAG
CAGGGCTTCCTCGACGACGTATACAAGGAGCGTCCGTCCGACAAGGTCGTGACCAGATTCCCGCCTGAGCCCAAC
GGCTATCTTCACATTGGCCACGCCAAGGCAATCGCTGTGAACTTTGGATTCGCCAGGCATCACGGCGGCGTGTGC
TATCTGCGCTACGACGACACCAATCCGGAGAAGGAAGAGGAGCAGTACTTTACCGCCATCAAGGACGTGGTGCAG
TGGCTCGGGTTCGAACCATTCAAGGTCACCTACTCGAGTGACAACTTTGCGAAGCTCTACGCCATGGCCGAGAAG
CTGGTGATGCTGGGAAAGGCTTACGTCTGCGCCTGCACCGGTAAGGGCAGCTCGTCTCGATGGCTACCGTCCTTT
GGCTGATCAGTCCTTGCTCAGACGTCGAGCTCAAGGACCAACGGGGAGGCGAAAAGGGCTCGCATCCCCGCTACC
GCTGTCAACACGCCGAGCAGTCCGTCGATGACAATCTGACCAAGTTTCGAGCCATGCGAGACGGCAAGTACAAGC
CCAAGGAGGTGTTTCTGCGCATGAAGCAGGACATTGTCGACAATAACCCCCAGATGTGGGACCTGGCCGCCTATC
GAATCAAGACGGACACCCCCCATCACCGTACGGGCCGAGACTGGGTCATCTATCCGACGTACGACTTTGCCCACT
GCCTATGCGACAGCTTCGAGGGCATCACGCATTCGCTCTGCACGACCGAGTTCATCCTGAGCCGAGTTTCATACG
AATGGCTCAACAAGACGCTCGAGGTTTACGAGCCGATGCAGAGGGAATACGGCCGGCTCAACCTGACGGGCACCG
TCCTCTCCAAGAGAAAGATTATCAAGCTCATCGAGGAAAAGATTGTACGCAGCTGGGACGATCCCAGACTGTACA
CGCTCATGGCCATCCGACGGCGCGGCGTGCCTCCAGGCGCCATTCTCGAATTCGTCAACGAGCTGGGTGTCACCA
CCAACATCACGGCGATCCAGATCAAGCGGTTCGAGCAGAGCGTGCGCAAGTACCTGGAGAAGACGGTGCCCCGGC
TGATGATGATACTCGACCCCGTGCCGTTGGTGATTGACGACGCCGAGGCGCTGGATCTCGACCTGCCCTTTTCCC
CCAAAGACCCCAAGATGGGCTCGCATACCGTCAAGTTTACGCCGACCGTCTACATTGACAGGGAGGATTTCAGAG
AGGTGGATAGCAAGGACTACTTCCGCCTCGCCCCCGGCAAGACGGTTGGCCTCCTCAATGTGCCTTTTCCGGTCA
AGGCCGTCTCCTTCAGCAAGGACCCGACGACGGGCAAAGTGACGGAGATTCGCGGCGTCTTTGACAAGGAGGCCA
AGAAGCCCAAGACGTACATTCAATGGGTCGGGACCGAGGGTACGAGAAAGGTCGAAGCTCGCATCCACAACCCGC
TCTTCAAGTCGGAGAAGCCCAACGACGCCGAGGGCGGGTACCTCAACGACGTCAATCCGGACAGCGAGGTCATAT
ATCCCGAGGCCGTGATCGAGTCGGGCTTTGATGAGGTTAGGAGGCGCGCGCCGTGGCCAGAGGCGGCTGGCGAGA
GCGAGCTCGGGAGGGGAGGGCCTGAGAGTGTGAGGTTCCAGGCGATGCGGGTTGCGTACTTTGTGAGTCCCTTCC
TGAGCGGTTCCGCTTGTGCTAGTTGCTGACCAGGCGTCGTGCAGGCTATGGATTCGGACAGCTCAGATGACAAGA
TTGTGCTGAACCGTATCGTGAGCTTGAAGGAGGACGCGGGCAAAAGGCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail