Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05559
Gene name
Locationscaffold_06:552611..554406
Strand+
Gene length (bp)1795
Transcript length (bp)1680
Coding sequence length (bp)1680
Protein length (aa) 560

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00324 AA_permease Amino acid permease 1.9E-98 42 509
PF13520 AA_permease_2 Amino acid permease 1.8E-29 44 474

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.5

Transmembrane Domains

Domain # Start End Length
1 44 66 22
2 71 90 19
3 122 144 22
4 154 176 22
5 181 203 22
6 240 262 22
7 275 297 22
8 333 355 22
9 376 398 22
10 413 435 22
11 455 477 22
12 487 504 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 539.67 236.66 842.67
Alive In ants, during behavior modification 99.23 51.76 146.70
Dead In ants, recently dead 115.93 64.09 167.76

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.406425 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05559
MADLEKQSSPPKALSPVVDVESGSSSGDNADDLHRMLNNRQIQLIAIGGSIGTALFVSIGNGLAVGGPGSLLIAY
TLYPLLLACVNNSIAEMTVLMPVSGGFIRLAGHWVDDAFGFMAGWNFFFYEALLIPFEITALNLVLSFWEPKMKD
PGPTAGICCAVILCYAALNILAVRGYGEAEFWLSGGKVILILMLFSFTFVTMLGGNPQHDRFGFRYWNDPGAFAQ
HHTTGSLGRFEGFLGALWNAAFAVVGPEYISMVAAEAQRPRVYIKAAFKTIYLRFGIFFLGSALAVGIIVPFNDP
TLVAVAKGEKGGGTAAASPYVIAMQNLGVSVLPHIVNALMFTSIFSAGNTYTYCATRSLYGLALEGRAPRFLRKC
WSNGVPIYCFCIVMCFPLLSFLQVGNGSALVLDWLVSLITAGGIIDYIVMSVTFLFYYRACKAQGVDRSKLPYHG
WGQPWCAIVALFFMTLVVIFYGYTAFTPWSVDGFFRHYTMQLVAPILFFGWKLFKRTRLVRPHEADLVWQRPTID
RYEESLTEDPVGFWTEMGHLVRINRPEKKPPLDK*
Coding >Ophcf2|05559
ATGGCCGACTTGGAGAAGCAATCGTCGCCTCCCAAGGCCCTCTCCCCCGTCGTCGACGTCGAATCAGGCTCCTCG
TCAGGCGACAACGCAGACGACCTTCACCGCATGCTCAACAACCGCCAGATTCAACTCATCGCCATCGGAGGCTCC
ATCGGAACCGCCCTCTTCGTCAGCATCGGCAATGGCCTGGCCGTGGGAGGCCCTGGCAGTCTCCTCATCGCCTAC
ACGCTGTACCCGCTGCTACTTGCCTGCGTCAACAACTCCATCGCCGAGATGACGGTCCTCATGCCCGTTTCCGGA
GGCTTCATCCGCCTCGCCGGTCATTGGGTGGACGATGCCTTTGGCTTCATGGCCGGTTGGAACTTCTTCTTCTAT
GAAGCCCTCCTCATCCCCTTTGAAATCACCGCCCTCAACCTCGTCCTCTCCTTCTGGGAACCCAAGATGAAGGAC
CCCGGCCCGACGGCCGGCATCTGCTGTGCCGTCATCCTCTGCTACGCTGCCCTCAACATCCTCGCCGTACGTGGC
TATGGTGAAGCCGAATTCTGGCTATCCGGAGGCAAGGTCATCCTCATCCTCATGCTCTTCTCCTTCACCTTCGTG
ACGATGCTCGGCGGGAACCCGCAACACGACCGCTTCGGCTTCCGCTACTGGAACGACCCCGGAGCCTTCGCCCAA
CACCACACGACCGGTTCCCTCGGCCGCTTCGAAGGCTTCCTCGGAGCCCTCTGGAACGCCGCCTTCGCCGTCGTC
GGTCCCGAGTACATCTCCATGGTGGCCGCCGAAGCTCAACGCCCTCGCGTCTACATCAAGGCCGCCTTCAAGACA
ATCTACCTCCGCTTCGGCATCTTCTTCCTCGGCAGCGCCCTCGCCGTCGGCATCATCGTCCCCTTCAACGACCCG
ACCCTCGTGGCCGTCGCAAAGGGCGAAAAGGGAGGGGGAACGGCCGCCGCATCCCCCTACGTCATCGCCATGCAG
AACCTCGGCGTCAGCGTCCTCCCTCACATCGTCAACGCCCTCATGTTCACCTCCATCTTCTCGGCCGGAAACACC
TACACCTACTGCGCCACCCGCTCCCTCTACGGCCTCGCCCTCGAGGGACGCGCCCCTCGCTTCCTCCGCAAATGC
TGGAGCAACGGCGTCCCCATCTACTGCTTCTGCATCGTCATGTGCTTCCCCCTCCTCTCCTTCCTACAAGTAGGC
AACGGCTCAGCCCTCGTCCTCGACTGGCTCGTCAGCCTCATCACCGCCGGCGGCATCATAGACTACATCGTCATG
TCCGTCACCTTCCTCTTCTACTACCGCGCCTGCAAAGCCCAGGGCGTCGACCGTTCCAAACTCCCCTACCACGGC
TGGGGCCAACCCTGGTGCGCCATCGTCGCCCTCTTCTTCATGACCCTCGTCGTCATCTTCTACGGCTACACCGCC
TTCACCCCCTGGTCCGTCGACGGCTTCTTCCGCCATTACACCATGCAGCTCGTCGCCCCCATCCTCTTCTTCGGA
TGGAAACTCTTCAAGCGCACCCGTCTCGTTCGTCCCCACGAGGCGGACCTCGTCTGGCAGAGGCCAACCATTGAC
CGATACGAGGAGAGTCTTACCGAGGATCCCGTCGGCTTCTGGACTGAGATGGGCCATCTCGTTCGCATCAACCGA
CCGGAGAAGAAGCCGCCGCTGGACAAGTGA
Transcript >Ophcf2|05559
ATGGCCGACTTGGAGAAGCAATCGTCGCCTCCCAAGGCCCTCTCCCCCGTCGTCGACGTCGAATCAGGCTCCTCG
TCAGGCGACAACGCAGACGACCTTCACCGCATGCTCAACAACCGCCAGATTCAACTCATCGCCATCGGAGGCTCC
ATCGGAACCGCCCTCTTCGTCAGCATCGGCAATGGCCTGGCCGTGGGAGGCCCTGGCAGTCTCCTCATCGCCTAC
ACGCTGTACCCGCTGCTACTTGCCTGCGTCAACAACTCCATCGCCGAGATGACGGTCCTCATGCCCGTTTCCGGA
GGCTTCATCCGCCTCGCCGGTCATTGGGTGGACGATGCCTTTGGCTTCATGGCCGGTTGGAACTTCTTCTTCTAT
GAAGCCCTCCTCATCCCCTTTGAAATCACCGCCCTCAACCTCGTCCTCTCCTTCTGGGAACCCAAGATGAAGGAC
CCCGGCCCGACGGCCGGCATCTGCTGTGCCGTCATCCTCTGCTACGCTGCCCTCAACATCCTCGCCGTACGTGGC
TATGGTGAAGCCGAATTCTGGCTATCCGGAGGCAAGGTCATCCTCATCCTCATGCTCTTCTCCTTCACCTTCGTG
ACGATGCTCGGCGGGAACCCGCAACACGACCGCTTCGGCTTCCGCTACTGGAACGACCCCGGAGCCTTCGCCCAA
CACCACACGACCGGTTCCCTCGGCCGCTTCGAAGGCTTCCTCGGAGCCCTCTGGAACGCCGCCTTCGCCGTCGTC
GGTCCCGAGTACATCTCCATGGTGGCCGCCGAAGCTCAACGCCCTCGCGTCTACATCAAGGCCGCCTTCAAGACA
ATCTACCTCCGCTTCGGCATCTTCTTCCTCGGCAGCGCCCTCGCCGTCGGCATCATCGTCCCCTTCAACGACCCG
ACCCTCGTGGCCGTCGCAAAGGGCGAAAAGGGAGGGGGAACGGCCGCCGCATCCCCCTACGTCATCGCCATGCAG
AACCTCGGCGTCAGCGTCCTCCCTCACATCGTCAACGCCCTCATGTTCACCTCCATCTTCTCGGCCGGAAACACC
TACACCTACTGCGCCACCCGCTCCCTCTACGGCCTCGCCCTCGAGGGACGCGCCCCTCGCTTCCTCCGCAAATGC
TGGAGCAACGGCGTCCCCATCTACTGCTTCTGCATCGTCATGTGCTTCCCCCTCCTCTCCTTCCTACAAGTAGGC
AACGGCTCAGCCCTCGTCCTCGACTGGCTCGTCAGCCTCATCACCGCCGGCGGCATCATAGACTACATCGTCATG
TCCGTCACCTTCCTCTTCTACTACCGCGCCTGCAAAGCCCAGGGCGTCGACCGTTCCAAACTCCCCTACCACGGC
TGGGGCCAACCCTGGTGCGCCATCGTCGCCCTCTTCTTCATGACCCTCGTCGTCATCTTCTACGGCTACACCGCC
TTCACCCCCTGGTCCGTCGACGGCTTCTTCCGCCATTACACCATGCAGCTCGTCGCCCCCATCCTCTTCTTCGGA
TGGAAACTCTTCAAGCGCACCCGTCTCGTTCGTCCCCACGAGGCGGACCTCGTCTGGCAGAGGCCAACCATTGAC
CGATACGAGGAGAGTCTTACCGAGGATCCCGTCGGCTTCTGGACTGAGATGGGCCATCTCGTTCGCATCAACCGA
CCGGAGAAGAAGCCGCCGCTGGACAAGTGA
Gene >Ophcf2|05559
ATGGCCGACTTGGAGAAGCAATCGTCGCCTCCCAAGGCCCTCTCCCCCGTCGTCGACGTCGAATCAGGCTCCTCG
TCAGGCGACAACGCAGACGACCTTCACCGCATGCTCAACAACCGCCAGATTCAACTCATCGCCATCGGAGGCTCC
ATCGGAACCGCCCTCTTCGTCAGCATCGGCAATGGCCTGGCCGTGGGAGGCCCTGGCAGTCTCCTCATCGCCTAC
ACGCTGTACCCGCTGCTACTTGCCTGCGTCAACAACTCCATCGCCGAGATGACGGTCCTCATGCCCGTTTCCGGA
GGCTTCATCCGCCTCGCCGGTCATTGGGTGGACGATGCCTTTGGCTTCATGGCCGGTTGGAACTTCTTCTTCTAT
GAAGCCCTCCTCATCCCCTTTGAAATCACCGCCCTCAACCTCGTCCTCTCCTTCTGGGAACCCAAGATGAAGGAC
CCCGGCCCGACGGCCGGCATCTGCTGTGCCGTCATCCTCTGCTACGCGTAAGACCATTGAGTGTTATTGAAGCGA
AACCCCCCAAACCCCCCCTTTCTGTCGAGATTCGCATGCTAAACATCGTCTTCCCCTCTCTTCTCTCTTGGTGCC
CCGAAAATGTAGTGCCCTCAACATCCTCGCCGTACGTGGCTATGGTGAAGCCGAATTCTGGCTATCCGGAGGCAA
GGTCATCCTCATCCTCATGCTCTTCTCCTTCACCTTCGTGACGATGCTCGGCGGGAACCCGCAACACGACCGCTT
CGGCTTCCGCTACTGGAACGACCCCGGAGCCTTCGCCCAACACCACACGACCGGTTCCCTCGGCCGCTTCGAAGG
CTTCCTCGGAGCCCTCTGGAACGCCGCCTTCGCCGTCGTCGGTCCCGAGTACATCTCCATGGTGGCCGCCGAAGC
TCAACGCCCTCGCGTCTACATCAAGGCCGCCTTCAAGACAATCTACCTCCGCTTCGGCATCTTCTTCCTCGGCAG
CGCCCTCGCCGTCGGCATCATCGTCCCCTTCAACGACCCGACCCTCGTGGCCGTCGCAAAGGGCGAAAAGGGAGG
GGGAACGGCCGCCGCATCCCCCTACGTCATCGCCATGCAGAACCTCGGCGTCAGCGTCCTCCCTCACATCGTCAA
CGCCCTCATGTTCACCTCCATCTTCTCGGCCGGAAACACCTACACCTACTGCGCCACCCGCTCCCTCTACGGCCT
CGCCCTCGAGGGACGCGCCCCTCGCTTCCTCCGCAAATGCTGGAGCAACGGCGTCCCCATCTACTGCTTCTGCAT
CGTCATGTGCTTCCCCCTCCTCTCCTTCCTACAAGTAGGCAACGGCTCAGCCCTCGTCCTCGACTGGCTCGTCAG
CCTCATCACCGCCGGCGGCATCATAGACTACATCGTCATGTCCGTCACCTTCCTCTTCTACTACCGCGCCTGCAA
AGCCCAGGGCGTCGACCGTTCCAAACTCCCCTACCACGGCTGGGGCCAACCCTGGTGCGCCATCGTCGCCCTCTT
CTTCATGACCCTCGTCGTCATCTTCTACGGCTACACCGCCTTCACCCCCTGGTCCGTCGACGGCTTCTTCCGCCA
TTACACCATGCAGCTCGTCGCCCCCATCCTCTTCTTCGGATGGAAACTCTTCAAGCGCACCCGTCTCGTTCGTCC
CCACGAGGCGGACCTCGTCTGGCAGAGGCCAACCATTGACCGATACGAGGAGAGTCTTACCGAGGATCCCGTCGG
CTTCTGGACTGAGATGGGCCATCTCGTTCGCATCAACCGACCGGAGAAGAAGCCGCCGCTGGACAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail