Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05555
Gene name
Locationscaffold_06:537959..540600
Strand-
Gene length (bp)2641
Transcript length (bp)2502
Coding sequence length (bp)2502
Protein length (aa) 834

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19277 GPAT_C Glycerol-3-phosphate acyltransferase C-terminal region 5.6E-159 344 761
PF01553 Acyltransferase Acyltransferase 4.0E-17 204 332

GO

GO Term Description Terminal node
GO:0016746 acyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.4493 0.3011 0.077 0.0598 0.2747 0.1205 0.2054 0.1139 0.2335 0.3836

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5586
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3031
Ophiocordyceps australis map64 (Brazil) OphauB2|1047
Ophiocordyceps camponoti-floridani Ophcf2|05555 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4404
Ophiocordyceps kimflemingae Ophio5|4228
Ophiocordyceps subramaniannii Hirsu2|7498

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05555
MAKGDDSFDPASGSAPDLQILGDEITLQPSGFVETQGSVEGREEALMNQFASFRAEPLQFLREVSLYVSGQGWRA
YDRVVGQPVFYTGFTERMKSSVMSAPLLQRRISELAEDRVAVEDKEGFFRNDKYHNIKRAQRRAVLESGLQEVAE
KLTDDMICKMESKTFIRGAYYFVTQLLTRAYHQGIHVSSEEVLRLRKVADMAAKTKKSIIFLPSHRSHVDYVSLQ
LICYRLGLTLPVVVAGDNLNFPLVGSFLQHAGAMWIRRSFGDDALYTALVQSYVDVLLQEGYNFECFIEGGRSRT
GKLLPPKFGILSFILDSLLSGRVDDAIICPVSTQYDKVIETEGYVTELLGMPKKKENLADFLSGGSLVLSLQLGR
VDVRFHEPWSLRKFIDEQLSRLPVVPAGLDTEHDRPQVKAVREKLLRTLGYKVLGDINDVSVVMPTALIGTVLLT
LRGRGVGKQELTRRVEWLTARIQAKGGRVAHFGNAPLSEIVDRGLEVLGKDLVGVVDGLLEPTYYAVDRFQLSFY
RNMTIHLFIYEALVSVSMYTRVKRGGGPSMQDMSHADLRAHVLFLSTLFRGEFIFSPAGLDANLDKTLGGLEADH
VVRLDRDANGNVTTVGLAPEERRAGRENYDFYCFLLWPFIEASWLAAVSLMGLAPLLGDEEGDVWLEQAKAQDSA
QLLGKTLYHQGDLSYFEAVNKETLKNSYSRFEQDQMMHVVKSRDPKIPPRIQLDAAWRPARDPVTGALLAEGKLW
DFTEKIASARREGKNRRDGATVSSRVLRLTDELGRRLFAEAKADDERGVKARVPSRLSREDRLALKRSVEDAKRR
RKPGRARL*
Coding >Ophcf2|05555
ATGGCCAAGGGCGACGACTCTTTCGACCCGGCCAGCGGCTCGGCCCCCGACTTGCAAATCTTGGGCGATGAGATC
ACGCTGCAACCCAGCGGCTTTGTCGAGACGCAAGGCTCCGTCGAGGGCAGGGAGGAAGCCTTGATGAACCAATTT
GCCTCGTTTCGAGCCGAACCGCTGCAGTTTCTTCGCGAAGTCTCGCTGTACGTTTCCGGTCAGGGATGGCGCGCC
TACGATCGGGTCGTCGGTCAGCCCGTCTTCTACACGGGCTTCACCGAGCGCATGAAGTCGTCCGTCATGTCGGCC
CCATTGCTCCAGCGGCGCATCTCGGAGTTGGCCGAGGATCGGGTCGCGGTCGAGGACAAGGAGGGCTTCTTTCGC
AACGACAAGTACCACAACATCAAGCGGGCTCAGCGACGGGCTGTGCTCGAGAGTGGGCTACAGGAGGTGGCGGAG
AAGCTGACGGACGACATGATTTGCAAGATGGAGAGCAAGACGTTCATCCGCGGCGCCTACTACTTTGTGACGCAG
CTCCTGACACGAGCCTATCATCAGGGCATCCACGTGTCGAGTGAAGAGGTGCTCCGACTGCGCAAGGTGGCCGAT
ATGGCGGCGAAGACGAAGAAGAGCATCATCTTTTTGCCGAGCCACCGATCACACGTGGACTACGTCTCGCTGCAG
CTCATCTGCTACCGACTCGGACTCACGCTGCCGGTGGTGGTTGCGGGAGACAACCTCAACTTTCCGCTGGTGGGC
AGCTTCCTACAGCACGCGGGCGCCATGTGGATTCGGAGATCGTTTGGCGACGACGCGCTATACACGGCGCTGGTT
CAGTCGTACGTGGACGTGTTACTGCAGGAAGGCTACAACTTTGAATGCTTCATCGAGGGCGGACGGTCGCGGACG
GGCAAGCTGCTGCCGCCCAAGTTTGGCATCCTCAGCTTCATCCTCGACAGCCTGCTGTCTGGCCGCGTCGACGAC
GCCATCATCTGTCCGGTCAGCACGCAGTACGACAAGGTCATCGAGACCGAAGGCTACGTGACGGAGCTTCTGGGT
ATGCCAAAGAAGAAGGAGAATCTGGCCGACTTCTTGTCTGGCGGGTCATTGGTGCTATCACTGCAACTTGGCCGC
GTCGATGTGCGCTTCCACGAGCCATGGAGCTTGCGGAAATTCATCGACGAGCAGCTTTCACGACTTCCCGTCGTA
CCAGCCGGCCTCGACACGGAGCACGATCGGCCACAGGTCAAGGCGGTGCGGGAGAAGCTGCTTCGGACGCTGGGC
TACAAGGTGCTGGGCGATATCAACGACGTGTCGGTGGTGATGCCTACGGCCCTCATCGGCACCGTTCTGCTGACG
CTCCGAGGTCGCGGTGTCGGCAAACAGGAGCTGACGCGAAGGGTAGAATGGCTGACGGCTCGGATCCAGGCCAAG
GGCGGACGCGTCGCTCACTTTGGCAACGCGCCGCTGTCCGAGATTGTCGACCGCGGGCTCGAGGTGCTGGGAAAG
GATCTGGTAGGCGTCGTCGACGGCCTGCTGGAGCCTACTTACTACGCCGTGGACCGCTTCCAGCTGTCCTTTTAC
CGCAACATGACGATTCATCTCTTTATCTACGAGGCCCTCGTCAGCGTCTCCATGTACACACGAGTCAAACGCGGC
GGCGGGCCATCGATGCAGGACATGTCACACGCCGATCTCCGTGCTCACGTCCTCTTCCTCTCGACGCTCTTTCGT
GGCGAGTTCATCTTCTCGCCAGCCGGTCTCGATGCCAACCTGGATAAGACACTTGGAGGGCTCGAGGCCGATCAC
GTTGTCCGCCTCGATCGCGACGCCAATGGCAACGTGACGACGGTTGGTCTCGCGCCTGAGGAGCGTCGAGCCGGG
CGTGAGAACTACGACTTTTACTGCTTCCTTCTGTGGCCCTTTATCGAGGCTAGCTGGCTGGCTGCCGTGTCGTTG
ATGGGCCTGGCGCCGCTGCTGGGCGACGAAGAGGGTGATGTTTGGCTCGAACAGGCCAAGGCGCAGGATAGCGCG
CAGCTGCTCGGCAAGACGCTCTACCATCAGGGCGACCTCTCTTACTTCGAAGCCGTCAACAAGGAGACGCTCAAG
AATTCGTACTCTCGCTTCGAGCAGGACCAGATGATGCACGTCGTCAAGTCTCGCGACCCCAAGATCCCCCCACGG
ATTCAACTCGACGCCGCCTGGCGTCCAGCCCGCGACCCAGTAACAGGCGCGCTGCTGGCCGAGGGTAAGCTCTGG
GACTTTACCGAGAAGATCGCCAGCGCGCGTCGCGAGGGTAAGAACCGGCGTGACGGCGCGACCGTCAGCTCTCGC
GTCCTTCGCCTCACCGATGAGCTTGGTCGGAGACTCTTTGCCGAGGCCAAGGCTGATGACGAGAGGGGCGTCAAG
GCGAGGGTGCCGAGCAGGTTGAGCCGTGAGGATAGGCTCGCGCTCAAGAGGAGCGTTGAGGATGCTAAGAGGAGG
AGGAAGCCGGGTAGAGCTCGTCTGTGA
Transcript >Ophcf2|05555
ATGGCCAAGGGCGACGACTCTTTCGACCCGGCCAGCGGCTCGGCCCCCGACTTGCAAATCTTGGGCGATGAGATC
ACGCTGCAACCCAGCGGCTTTGTCGAGACGCAAGGCTCCGTCGAGGGCAGGGAGGAAGCCTTGATGAACCAATTT
GCCTCGTTTCGAGCCGAACCGCTGCAGTTTCTTCGCGAAGTCTCGCTGTACGTTTCCGGTCAGGGATGGCGCGCC
TACGATCGGGTCGTCGGTCAGCCCGTCTTCTACACGGGCTTCACCGAGCGCATGAAGTCGTCCGTCATGTCGGCC
CCATTGCTCCAGCGGCGCATCTCGGAGTTGGCCGAGGATCGGGTCGCGGTCGAGGACAAGGAGGGCTTCTTTCGC
AACGACAAGTACCACAACATCAAGCGGGCTCAGCGACGGGCTGTGCTCGAGAGTGGGCTACAGGAGGTGGCGGAG
AAGCTGACGGACGACATGATTTGCAAGATGGAGAGCAAGACGTTCATCCGCGGCGCCTACTACTTTGTGACGCAG
CTCCTGACACGAGCCTATCATCAGGGCATCCACGTGTCGAGTGAAGAGGTGCTCCGACTGCGCAAGGTGGCCGAT
ATGGCGGCGAAGACGAAGAAGAGCATCATCTTTTTGCCGAGCCACCGATCACACGTGGACTACGTCTCGCTGCAG
CTCATCTGCTACCGACTCGGACTCACGCTGCCGGTGGTGGTTGCGGGAGACAACCTCAACTTTCCGCTGGTGGGC
AGCTTCCTACAGCACGCGGGCGCCATGTGGATTCGGAGATCGTTTGGCGACGACGCGCTATACACGGCGCTGGTT
CAGTCGTACGTGGACGTGTTACTGCAGGAAGGCTACAACTTTGAATGCTTCATCGAGGGCGGACGGTCGCGGACG
GGCAAGCTGCTGCCGCCCAAGTTTGGCATCCTCAGCTTCATCCTCGACAGCCTGCTGTCTGGCCGCGTCGACGAC
GCCATCATCTGTCCGGTCAGCACGCAGTACGACAAGGTCATCGAGACCGAAGGCTACGTGACGGAGCTTCTGGGT
ATGCCAAAGAAGAAGGAGAATCTGGCCGACTTCTTGTCTGGCGGGTCATTGGTGCTATCACTGCAACTTGGCCGC
GTCGATGTGCGCTTCCACGAGCCATGGAGCTTGCGGAAATTCATCGACGAGCAGCTTTCACGACTTCCCGTCGTA
CCAGCCGGCCTCGACACGGAGCACGATCGGCCACAGGTCAAGGCGGTGCGGGAGAAGCTGCTTCGGACGCTGGGC
TACAAGGTGCTGGGCGATATCAACGACGTGTCGGTGGTGATGCCTACGGCCCTCATCGGCACCGTTCTGCTGACG
CTCCGAGGTCGCGGTGTCGGCAAACAGGAGCTGACGCGAAGGGTAGAATGGCTGACGGCTCGGATCCAGGCCAAG
GGCGGACGCGTCGCTCACTTTGGCAACGCGCCGCTGTCCGAGATTGTCGACCGCGGGCTCGAGGTGCTGGGAAAG
GATCTGGTAGGCGTCGTCGACGGCCTGCTGGAGCCTACTTACTACGCCGTGGACCGCTTCCAGCTGTCCTTTTAC
CGCAACATGACGATTCATCTCTTTATCTACGAGGCCCTCGTCAGCGTCTCCATGTACACACGAGTCAAACGCGGC
GGCGGGCCATCGATGCAGGACATGTCACACGCCGATCTCCGTGCTCACGTCCTCTTCCTCTCGACGCTCTTTCGT
GGCGAGTTCATCTTCTCGCCAGCCGGTCTCGATGCCAACCTGGATAAGACACTTGGAGGGCTCGAGGCCGATCAC
GTTGTCCGCCTCGATCGCGACGCCAATGGCAACGTGACGACGGTTGGTCTCGCGCCTGAGGAGCGTCGAGCCGGG
CGTGAGAACTACGACTTTTACTGCTTCCTTCTGTGGCCCTTTATCGAGGCTAGCTGGCTGGCTGCCGTGTCGTTG
ATGGGCCTGGCGCCGCTGCTGGGCGACGAAGAGGGTGATGTTTGGCTCGAACAGGCCAAGGCGCAGGATAGCGCG
CAGCTGCTCGGCAAGACGCTCTACCATCAGGGCGACCTCTCTTACTTCGAAGCCGTCAACAAGGAGACGCTCAAG
AATTCGTACTCTCGCTTCGAGCAGGACCAGATGATGCACGTCGTCAAGTCTCGCGACCCCAAGATCCCCCCACGG
ATTCAACTCGACGCCGCCTGGCGTCCAGCCCGCGACCCAGTAACAGGCGCGCTGCTGGCCGAGGGTAAGCTCTGG
GACTTTACCGAGAAGATCGCCAGCGCGCGTCGCGAGGGTAAGAACCGGCGTGACGGCGCGACCGTCAGCTCTCGC
GTCCTTCGCCTCACCGATGAGCTTGGTCGGAGACTCTTTGCCGAGGCCAAGGCTGATGACGAGAGGGGCGTCAAG
GCGAGGGTGCCGAGCAGGTTGAGCCGTGAGGATAGGCTCGCGCTCAAGAGGAGCGTTGAGGATGCTAAGAGGAGG
AGGAAGCCGGGTAGAGCTCGTCTGTGA
Gene >Ophcf2|05555
ATGGCCAAGGGCGACGACTCTTTCGACCCGGCCAGCGGCTCGGCCCCCGACTTGCAAATCTTGGGCGATGAGATC
ACGCTGCAACCCAGCGGCTTTGTCGAGACGCAAGGCTCCGTCGAGGGCAGGGAGGAAGCCTTGATGAACCAATTT
GCCTCGTTTCGAGCCGAACCGCTGCAGTCAGTGGCCATATGCCGTCCACTTTGAATTGGATTGTCGCTAATGTCC
TGGTGGTCTTTAGGTTTCTTCGCGAAGTCTCGCTGTACGTTTCCGGTCAGGGATGGCGCGCCTACGATCGGGTCG
TCGGTCAGCCCGTCTTCTACACGGGCTTCACCGAGCGCATGAAGTCGTCCGTCATGTCGGCCCCATTGCTCCAGC
GGCGCATCTCGGAGTTGGCCGAGGATCGGGTCGCGGTCGAGGACAAGGAGGGCTTCTTTCGCAACGACAAGTACC
ACAACATCAAGCGGGCTCAGCGACGGGCTGTGCTCGAGAGTGGGCTACAGGAGGTGGCGGAGAAGCTGACGGACG
ACATGATTTGCAAGATGGAGAGCAAGACGTTCATCCGCGGCGCCTACTACTTTGTGACGCAGCTCCTGACACGAG
CCTATCATCAGGGCATCCACGTGTCGAGTGAAGAGGTGCTCCGACTGCGCAAGGTGGCCGATATGGCGGCGAAGA
CGAAGAAGAGCATCATCTTTTTGCCGAGCCACCGATCACACGTGGACTACGTCTCGCTGCAGCTCATCTGCTACC
GACTCGGACTCACGCTGCCGGTGGTGGTTGCGGGAGACAACCTCAACTTTCCGCTGGTGGGCAGCTTCCTACAGC
ACGCGGGCGCCATGTGGATTCGGAGATCGTTTGGCGACGACGCGCTATACACGGCGCTGGTTCAGTCGTACGTGG
ACGTGTTACTGCAGGAAGGCTACAACTTTGAATGCTTCATCGAGGGCGGACGGTCGCGGACGGGCAAGCTGCTGC
CGCCCAAGTTTGGCATCCTCAGCTTCATCCTCGACAGCCTGCTGTCTGGCCGCGTCGACGACGCCATCATCTGTC
CGGTCAGCACGCAGTACGACAAGGTCATCGAGACCGAAGGCTACGTGACGGAGCTTCTGGGTATGCCAAAGAAGA
AGGAGAATCTGGCCGACTTCTTGTCTGGCGGGTCATTGGTGCTATCACTGCAACTTGGCCGCGTCGATGTGCGCT
TCCACGAGCCATGGAGCTTGCGGAAATTCATCGACGAGCAGCTTTCACGACTTCCCGTCGTACCAGCCGGCCTCG
ACACGGAGCACGATCGGCCACAGGTCAAGGCGGTGCGGGAGAAGCTGCTTCGGACGCTGGGCTACAAGGTGCTGG
GCGATATCAACGACGTGTCGGTGGTGATGCCTACGGCCCTCATCGGCACCGTTCTGCTGACGCTCCGAGGTCGCG
GTGTCGGCAAACAGGAGCTGACGCGAAGGGTAGAATGGCTGACGGCTCGGATCCAGGCCAAGGGCGGACGCGTCG
CTCACTTTGGCAACGCGCCGCTGTCCGAGATTGTCGACCGCGGGCTCGAGGTGCTGGGAAAGGATCTGGTAGGCG
TCGTCGACGGCCTGCTGGAGCCTACTTACTACGCCGTGGACCGCTTCCAGCTGTCCTTTTACCGCAACATGACGA
TTCATCTCTTTATCTACGAGGCCCTCGTCAGCGTCTCCATGTACACACGAGTCAAACGCGGCGGCGGGCCATCGA
TGCAGGACATGTCACACGCCGATCTCCGTGCTCACGTCCTCTTCCTCTCGACGCTCTTTCGTGGCGAGTTCATCT
TCTCGCCAGCCGGTCTCGATGCCAACCTGGATAAGACACTTGGAGGGCTCGAGGCCGATCACGTTGTCCGCCTCG
ATCGCGACGCCAATGGCAACGTGACGACGGTTGGTCTCGCGCCTGAGGAGCGTCGAGCCGGGCGTGAGAACTACG
ACTTTTACTGCTTCCTTCTGTGGCCCTTTATCGAGGCTAGCTGGCTGGCTGCCGTGTCGTTGATGGGCCTGGCGC
CGCTGCTGGGCGACGAAGAGGGTGATGTTTGGCTCGAACAGGCCAAGGCGCAGGATAGCGCGCAGCTGGTGGGTG
TTTCCCCCCCCTTATTCCTCGTCTTGTTGGTTTCACTTGACCTCGCTGACGTTGACGATATCGGGCACAGCTCGG
CAAGACGCTCTACCATCAGGGCGACCTCTCTTACTTCGAAGCCGTCAACAAGGAGACGCTCAAGAATTCGTACTC
TCGCTTCGAGCAGGACCAGATGATGCACGTCGTCAAGTCTCGCGACCCCAAGATCCCCCCACGGATTCAACTCGA
CGCCGCCTGGCGTCCAGCCCGCGACCCAGTAACAGGCGCGCTGCTGGCCGAGGGTAAGCTCTGGGACTTTACCGA
GAAGATCGCCAGCGCGCGTCGCGAGGGTAAGAACCGGCGTGACGGCGCGACCGTCAGCTCTCGCGTCCTTCGCCT
CACCGATGAGCTTGGTCGGAGACTCTTTGCCGAGGCCAAGGCTGATGACGAGAGGGGCGTCAAGGCGAGGGTGCC
GAGCAGGTTGAGCCGTGAGGATAGGCTCGCGCTCAAGAGGAGCGTTGAGGATGCTAAGAGGAGGAGGAAGCCGGG
TAGAGCTCGTCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail