Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05518
Gene name
Locationscaffold_06:454965..456894
Strand+
Gene length (bp)1929
Transcript length (bp)1803
Coding sequence length (bp)1803
Protein length (aa) 601

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01363 FYVE FYVE zinc finger 7.2E-18 250 332
PF11464 Rbsn Rabenosyn Rab binding domain 1.5E-13 541 579

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum|Lysosome/Vacuole Signal peptide|Transmembrane domain 0.444 0.2495 0.0305 0.2377 0.0987 0.0047 0.685 0.9284 0.381 0.0114

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup960
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5519
Ophiocordyceps australis map64 (Brazil) OphauB2|2188
Ophiocordyceps camponoti-floridani Ophcf2|05518 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3791
Ophiocordyceps kimflemingae Ophio5|5028
Ophiocordyceps subramaniannii Hirsu2|7325
Ophiocordyceps subramaniannii Hirsu2|7326

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05518
MMTLLQLNRHIDDNHQELPEQEQDEVKTWFDKQVLKAKRFQPLTLINQKLRGLDVFESNESNPLPATTMTTSTTS
NGKQPATTPIDPDDIITRSHWQRSTTHDVCTDPACGRGLGPLNGSINCRKCGRLFCEEHTMYQMKLSRSANHEPV
RGYWARVCETCYKSREGYNDHVGLEVDDTEFFVGARCKRLERQKLETARLEKRLTKLTRLLAEMPEGNAVVPGGA
SLLSPVSSLIGHKDPRKLLEQSVVPWEDDDAVSKCPFCQQEFGSWTFRRHHCRICGRVVCADVQTGCSSEVGLNI
RSSAVTTPYSDEKSAPQLQAEIRMCRDCKQTIFSHRDFTTSLEHKPPDQKAYETLRQFERGILLLLPSFHRSLLA
LQPRANTSDASSSSWSSSATQTPTPTPTQAQIHEAAKIRKRLMDSFAKYGAAAKRLRALKAESRTQARLQEAVYQ
YASSFLHANMLPLKSLPRLLRDSSTPHAHPPLPPRSTRTPQSSSSLRHTQLATPPEPSSASTTTTMTTATTTATT
LLEEQERDAKQRLAILREQRQMVEDMVSKATAARRFDEVAALARNRDELDLEIEGVERLVSEVDGRWEGVYADGS
*
Coding >Ophcf2|05518
ATGATGACGCTTCTTCAGCTTAATCGACATATCGACGATAACCACCAGGAACTCCCCGAGCAGGAGCAGGATGAG
GTCAAGACTTGGTTCGACAAGCAGGTCCTCAAAGCCAAGCGCTTCCAACCCTTGACACTCATCAACCAGAAACTC
CGAGGCCTCGACGTCTTCGAATCCAACGAGTCTAACCCGCTCCCCGCAACGACAATGACAACATCAACGACATCA
AACGGCAAGCAACCCGCCACCACCCCCATCGACCCAGACGACATCATCACCAGGAGTCACTGGCAACGCTCAACA
ACACACGACGTCTGCACAGACCCCGCCTGCGGACGCGGCCTCGGCCCCCTGAACGGCAGCATCAACTGCCGCAAG
TGCGGCCGCCTCTTCTGCGAGGAGCACACAATGTACCAGATGAAGCTCAGCCGGAGCGCCAACCACGAACCCGTC
CGGGGCTACTGGGCCCGCGTGTGCGAGACCTGCTACAAGTCGCGCGAAGGGTACAACGATCACGTCGGACTCGAG
GTCGATGACACGGAATTCTTCGTCGGTGCGCGCTGCAAGAGGCTTGAGCGGCAGAAGCTCGAGACGGCTAGGTTG
GAGAAGAGGCTCACCAAGTTGACGCGTTTGCTGGCCGAGATGCCCGAGGGTAACGCCGTCGTGCCGGGGGGGGCT
TCGCTTCTCAGTCCCGTCTCGTCGCTCATCGGTCATAAGGATCCGCGTAAGTTGCTGGAGCAGTCCGTCGTGCCG
TGGGAGGATGACGACGCCGTTTCCAAGTGTCCCTTTTGTCAGCAAGAGTTTGGAAGCTGGACTTTTAGAAGACAT
CACTGTCGGATATGCGGTCGTGTCGTCTGCGCCGATGTCCAGACGGGCTGCTCCTCCGAAGTCGGTCTCAACATC
CGCAGCAGCGCCGTGACGACCCCCTACTCGGACGAGAAAAGCGCCCCCCAACTCCAAGCCGAGATCCGCATGTGC
CGCGACTGCAAGCAAACCATCTTCTCCCACCGCGACTTCACCACCTCCCTCGAGCACAAACCCCCCGATCAAAAA
GCCTACGAAACCCTCCGCCAATTCGAACGCGGCATCCTCCTCCTCCTCCCTTCGTTCCACCGCTCCCTCCTCGCC
CTCCAACCACGGGCGAATACATCGGACGCTTCGTCGTCGTCTTGGTCCTCTTCCGCGACGCAGACGCCAACGCCT
ACACCTACGCAGGCGCAGATTCACGAAGCGGCCAAGATTCGGAAACGGTTGATGGATAGCTTTGCAAAGTATGGT
GCTGCGGCGAAGCGGCTTCGTGCTTTGAAGGCAGAGTCTAGGACGCAGGCTCGGCTACAGGAAGCCGTCTATCAA
TATGCAAGTTCCTTCTTGCACGCAAACATGCTCCCGCTCAAGAGCCTCCCCCGCCTCCTCCGCGACTCCTCAACT
CCCCATGCCCATCCTCCCCTCCCCCCCCGATCAACACGCACCCCCCAATCATCATCCAGCCTCCGTCACACCCAG
CTCGCCACCCCCCCGGAACCAAGCTCGGCAAGCACAACAACTACAATGACAACCGCGACCACAACCGCAACAACG
CTACTGGAGGAACAAGAGCGCGACGCCAAGCAACGACTCGCCATCCTCCGCGAGCAACGTCAAATGGTGGAGGAC
ATGGTCTCAAAGGCCACCGCCGCCAGACGCTTCGACGAGGTGGCCGCCCTGGCGAGGAACAGGGACGAGCTTGAC
CTTGAGATTGAGGGGGTGGAGCGGTTGGTCAGCGAGGTGGATGGGAGGTGGGAGGGGGTCTATGCCGATGGTTCT
TGA
Transcript >Ophcf2|05518
ATGATGACGCTTCTTCAGCTTAATCGACATATCGACGATAACCACCAGGAACTCCCCGAGCAGGAGCAGGATGAG
GTCAAGACTTGGTTCGACAAGCAGGTCCTCAAAGCCAAGCGCTTCCAACCCTTGACACTCATCAACCAGAAACTC
CGAGGCCTCGACGTCTTCGAATCCAACGAGTCTAACCCGCTCCCCGCAACGACAATGACAACATCAACGACATCA
AACGGCAAGCAACCCGCCACCACCCCCATCGACCCAGACGACATCATCACCAGGAGTCACTGGCAACGCTCAACA
ACACACGACGTCTGCACAGACCCCGCCTGCGGACGCGGCCTCGGCCCCCTGAACGGCAGCATCAACTGCCGCAAG
TGCGGCCGCCTCTTCTGCGAGGAGCACACAATGTACCAGATGAAGCTCAGCCGGAGCGCCAACCACGAACCCGTC
CGGGGCTACTGGGCCCGCGTGTGCGAGACCTGCTACAAGTCGCGCGAAGGGTACAACGATCACGTCGGACTCGAG
GTCGATGACACGGAATTCTTCGTCGGTGCGCGCTGCAAGAGGCTTGAGCGGCAGAAGCTCGAGACGGCTAGGTTG
GAGAAGAGGCTCACCAAGTTGACGCGTTTGCTGGCCGAGATGCCCGAGGGTAACGCCGTCGTGCCGGGGGGGGCT
TCGCTTCTCAGTCCCGTCTCGTCGCTCATCGGTCATAAGGATCCGCGTAAGTTGCTGGAGCAGTCCGTCGTGCCG
TGGGAGGATGACGACGCCGTTTCCAAGTGTCCCTTTTGTCAGCAAGAGTTTGGAAGCTGGACTTTTAGAAGACAT
CACTGTCGGATATGCGGTCGTGTCGTCTGCGCCGATGTCCAGACGGGCTGCTCCTCCGAAGTCGGTCTCAACATC
CGCAGCAGCGCCGTGACGACCCCCTACTCGGACGAGAAAAGCGCCCCCCAACTCCAAGCCGAGATCCGCATGTGC
CGCGACTGCAAGCAAACCATCTTCTCCCACCGCGACTTCACCACCTCCCTCGAGCACAAACCCCCCGATCAAAAA
GCCTACGAAACCCTCCGCCAATTCGAACGCGGCATCCTCCTCCTCCTCCCTTCGTTCCACCGCTCCCTCCTCGCC
CTCCAACCACGGGCGAATACATCGGACGCTTCGTCGTCGTCTTGGTCCTCTTCCGCGACGCAGACGCCAACGCCT
ACACCTACGCAGGCGCAGATTCACGAAGCGGCCAAGATTCGGAAACGGTTGATGGATAGCTTTGCAAAGTATGGT
GCTGCGGCGAAGCGGCTTCGTGCTTTGAAGGCAGAGTCTAGGACGCAGGCTCGGCTACAGGAAGCCGTCTATCAA
TATGCAAGTTCCTTCTTGCACGCAAACATGCTCCCGCTCAAGAGCCTCCCCCGCCTCCTCCGCGACTCCTCAACT
CCCCATGCCCATCCTCCCCTCCCCCCCCGATCAACACGCACCCCCCAATCATCATCCAGCCTCCGTCACACCCAG
CTCGCCACCCCCCCGGAACCAAGCTCGGCAAGCACAACAACTACAATGACAACCGCGACCACAACCGCAACAACG
CTACTGGAGGAACAAGAGCGCGACGCCAAGCAACGACTCGCCATCCTCCGCGAGCAACGTCAAATGGTGGAGGAC
ATGGTCTCAAAGGCCACCGCCGCCAGACGCTTCGACGAGGTGGCCGCCCTGGCGAGGAACAGGGACGAGCTTGAC
CTTGAGATTGAGGGGGTGGAGCGGTTGGTCAGCGAGGTGGATGGGAGGTGGGAGGGGGTCTATGCCGATGGTTCT
TGA
Gene >Ophcf2|05518
ATGGTAAGGTCGAGACTTGGGTTTGGTTTTTATTGCCTTGTTGATGGTGGGTTGCTGCAGATGACGCTTCTTCAG
CTTAATCGACATATCGACGATAACCACCAGGAACTCCCCGAGCAGGAGCAGGATGAGGTCAAGACTTGGTTCGAC
AAGCAGGTCCTCAAAGCCAAGCGCTTCCAACCCTTGACACTCATCAACCAGAAACTCCGAGGCCTCGACGTCTTC
GAATCCAACGAGTCTAACCCGCTCCCCGCAACGACAATGACAACATCAACGACATCAAACGGCAAGCAACCCGCC
ACCACCCCCATCGACCCAGACGACATCATCACCAGGAGTCACTGGCAACGCTCAACAACACACGACGTCTGCACA
GACCCCGCCTGCGGACGCGGCCTCGGCCCCCTGAACGGCAGCATCAACTGCCGCAAGTGCGGCCGCCTCTTCTGC
GAGGAGCACACAATGTACCAGATGAAGCTCAGCCGGAGCGCCAACCACGAACCCGTCCGGGGCTACTGGGCCCGC
GTGTGCGAGACCTGCTACAAGTCGCGCGAAGGGTACAACGATCACGTCGGACTCGAGGTCGATGACACGGAATTC
TTCGTCGGTGCGCGCTGCAAGAGGCTTGAGCGGCAGAAGCTCGAGACGGCTAGGTTGGAGAAGAGGCTCACCAAG
TTGACGCGTTTGCTGGCCGAGATGCCCGAGGGTAACGCCGTCGTGCCGGGGGGGGCTTCGCTTCTCAGTCCCGTC
TCGTCGCTCATCGGTCATAAGGATCCGCGTAAGTTGCTGGAGCAGTCCGTCGTGCCGTGGGAGGATGACGACGCC
GTTTCCAAGTGTCCCTTTTGTCAGCAAGAGTTTGGAAGCTGGACTTTTAGAAGACATCACTGTCGGATATGCGGT
CGTGTCGTCTGCGCCGATGTCCAGACGGGCTGCTCCTCCGAAGTCGGTCTCAACATCCGCAGCAGCGGTACGTTC
AAACAAACCCGGCCCATCATCATCACTCTTCTATCCTCAACTGACCAAAACTCCCTCTCAGCCGTGACGACCCCC
TACTCGGACGAGAAAAGCGCCCCCCAACTCCAAGCCGAGATCCGCATGTGCCGCGACTGCAAGCAAACCATCTTC
TCCCACCGCGACTTCACCACCTCCCTCGAGCACAAACCCCCCGATCAAAAAGCCTACGAAACCCTCCGCCAATTC
GAACGCGGCATCCTCCTCCTCCTCCCTTCGTTCCACCGCTCCCTCCTCGCCCTCCAACCACGGGCGAATACATCG
GACGCTTCGTCGTCGTCTTGGTCCTCTTCCGCGACGCAGACGCCAACGCCTACACCTACGCAGGCGCAGATTCAC
GAAGCGGCCAAGATTCGGAAACGGTTGATGGATAGCTTTGCAAAGTATGGTGCTGCGGCGAAGCGGCTTCGTGCT
TTGAAGGCAGAGTCTAGGACGCAGGCTCGGCTACAGGAAGCCGTCTATCAATATGCAAGTTCCTTCTTGCACGCA
AACATGCTCCCGCTCAAGAGCCTCCCCCGCCTCCTCCGCGACTCCTCAACTCCCCATGCCCATCCTCCCCTCCCC
CCCCGATCAACACGCACCCCCCAATCATCATCCAGCCTCCGTCACACCCAGCTCGCCACCCCCCCGGAACCAAGC
TCGGCAAGCACAACAACTACAATGACAACCGCGACCACAACCGCAACAACGCTACTGGAGGAACAAGAGCGCGAC
GCCAAGCAACGACTCGCCATCCTCCGCGAGCAACGTCAAATGGTGGAGGACATGGTCTCAAAGGCCACCGCCGCC
AGACGCTTCGACGAGGTGGCCGCCCTGGCGAGGAACAGGGACGAGCTTGACCTTGAGATTGAGGGGGTGGAGCGG
TTGGTCAGCGAGGTGGATGGGAGGTGGGAGGGGGTCTATGCCGATGGTTCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail