Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05514
Gene name
Locationscaffold_06:448002..448611
Strand-
Gene length (bp)609
Transcript length (bp)609
Coding sequence length (bp)609
Protein length (aa) 203

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07335 Glyco_hydro_75 Fungal chitosanase of glycosyl hydrolase group 75 1.2E-63 1 170

GO

GO Term Description Terminal node
GO:0016977 chitosanase activity Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0003824 catalytic activity No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane 0.1188 0.0498 0.6193 0.7237 0.1379 0.1611 0.2032 0.4155 0.2263 0.0953

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH75 6.0E-58 1 170

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5009
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|05514 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|221
Ophiocordyceps kimflemingae Ophio5|7749
Ophiocordyceps subramaniannii Hirsu2|2423
Ophiocordyceps subramaniannii Hirsu2|2424

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05514
MDIDCDGDSTAPFNDTRCKSSLDTQSQTSFREELAPYGITDLNANIHTYVVFGNTGSKPGWPTFDPAAHGIKPLS
VMAVVCGQRLVYGIWGDTNGDDGKKAMVGEASISLATACYGDSVDGDQGHDENDVLYLAFPGEAAVPGPDGAAWN
ASDPLEFERSLEPIGDMLVSGIGDVSSGRRARLPHAAGRLLVAAVTLAGLGV*
Coding >Ophcf2|05514
ATGGATATCGACTGCGACGGCGACTCCACCGCCCCCTTCAACGACACCCGCTGCAAGAGCTCGCTCGACACCCAA
TCGCAGACAAGCTTCCGCGAAGAACTCGCCCCCTATGGAATCACGGATCTAAACGCAAACATACACACCTACGTC
GTCTTCGGAAACACGGGCTCGAAACCGGGCTGGCCGACCTTCGATCCAGCCGCCCACGGCATCAAGCCCCTGAGC
GTCATGGCCGTAGTCTGCGGCCAGCGTCTCGTCTACGGCATCTGGGGCGATACCAACGGCGATGATGGGAAAAAG
GCCATGGTCGGAGAGGCTTCCATCTCGCTGGCTACGGCTTGCTACGGGGATTCCGTCGATGGCGATCAGGGTCAT
GATGAGAATGATGTGCTGTATCTTGCTTTTCCGGGTGAGGCTGCTGTGCCTGGACCCGATGGCGCGGCCTGGAAC
GCGTCCGATCCGCTCGAGTTTGAGCGCAGTCTTGAACCTATCGGTGATATGTTGGTGAGTGGCATCGGGGACGTC
TCTTCTGGGAGGCGGGCTCGCCTTCCTCATGCCGCGGGTCGCTTGTTGGTGGCCGCCGTGACGCTGGCGGGCTTG
GGGGTGTGA
Transcript >Ophcf2|05514
ATGGATATCGACTGCGACGGCGACTCCACCGCCCCCTTCAACGACACCCGCTGCAAGAGCTCGCTCGACACCCAA
TCGCAGACAAGCTTCCGCGAAGAACTCGCCCCCTATGGAATCACGGATCTAAACGCAAACATACACACCTACGTC
GTCTTCGGAAACACGGGCTCGAAACCGGGCTGGCCGACCTTCGATCCAGCCGCCCACGGCATCAAGCCCCTGAGC
GTCATGGCCGTAGTCTGCGGCCAGCGTCTCGTCTACGGCATCTGGGGCGATACCAACGGCGATGATGGGAAAAAG
GCCATGGTCGGAGAGGCTTCCATCTCGCTGGCTACGGCTTGCTACGGGGATTCCGTCGATGGCGATCAGGGTCAT
GATGAGAATGATGTGCTGTATCTTGCTTTTCCGGGTGAGGCTGCTGTGCCTGGACCCGATGGCGCGGCCTGGAAC
GCGTCCGATCCGCTCGAGTTTGAGCGCAGTCTTGAACCTATCGGTGATATGTTGGTGAGTGGCATCGGGGACGTC
TCTTCTGGGAGGCGGGCTCGCCTTCCTCATGCCGCGGGTCGCTTGTTGGTGGCCGCCGTGACGCTGGCGGGCTTG
GGGGTGTGA
Gene >Ophcf2|05514
ATGGATATCGACTGCGACGGCGACTCCACCGCCCCCTTCAACGACACCCGCTGCAAGAGCTCGCTCGACACCCAA
TCGCAGACAAGCTTCCGCGAAGAACTCGCCCCCTATGGAATCACGGATCTAAACGCAAACATACACACCTACGTC
GTCTTCGGAAACACGGGCTCGAAACCGGGCTGGCCGACCTTCGATCCAGCCGCCCACGGCATCAAGCCCCTGAGC
GTCATGGCCGTAGTCTGCGGCCAGCGTCTCGTCTACGGCATCTGGGGCGATACCAACGGCGATGATGGGAAAAAG
GCCATGGTCGGAGAGGCTTCCATCTCGCTGGCTACGGCTTGCTACGGGGATTCCGTCGATGGCGATCAGGGTCAT
GATGAGAATGATGTGCTGTATCTTGCTTTTCCGGGTGAGGCTGCTGTGCCTGGACCCGATGGCGCGGCCTGGAAC
GCGTCCGATCCGCTCGAGTTTGAGCGCAGTCTTGAACCTATCGGTGATATGTTGGTGAGTGGCATCGGGGACGTC
TCTTCTGGGAGGCGGGCTCGCCTTCCTCATGCCGCGGGTCGCTTGTTGGTGGCCGCCGTGACGCTGGCGGGCTTG
GGGGTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail