Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05513
Gene name
Locationscaffold_06:445099..446816
Strand+
Gene length (bp)1717
Transcript length (bp)1575
Coding sequence length (bp)1575
Protein length (aa) 525

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.2E-12 69 399
PF00083 Sugar_tr Sugar (and other) transporter 1.4E-09 103 512

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

Domain # Start End Length
1 67 89 22
2 104 123 19
3 136 158 22
4 232 254 22
5 339 361 22
6 376 398 22
7 410 428 18
8 432 454 22
9 467 489 22
10 494 516 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05513
MGVENAVDEVVTSPHDPPIYSSSIELASDGDSAIIPKGAIDPVYEAKARLLNRAIRDMGMGWYQWQLFVVVGFGW
ASDNLWPVVTALIFTPIAQEFHPDRPPLFTLAQNIGLLAGAAFWGFGCDVFGRKLGFNLTLGLTAFWGLVAASAP
SFAAIGFFACMWSFGVGGNLPVDSAVFLEFLPQSHQYLLTVLSIDWSLAQVIANLIAWPLLTKFTCSQEQAQSCS
RRDNMGWRYFTLAMGGLTLIMFITRFVFFTIYESPKYLVGKGRDADAVRVLHEVARRNGTTVTLTLEDLKACEPD
GYVARTDTSAAVKRYMEKVDTQHVKALFAGRRLATSTGLIMAIWALIGLGYPLYNAFLPFIQATRGVQFQDGSNN
ITYRNSLIIAVLGVPGAILGGFLVELPRMGRKGTLSLFTLLTGVFLFCSTTAANSTALLGWNCAFNFCSNVMYAV
LYGYTPEIFPTPQRGTGNALCASCNRVFGIMAPIVAMFANLQTAAPVYGSGALFLSAGALVLFLPFESQGREAL*
Coding >Ophcf2|05513
ATGGGTGTTGAGAACGCTGTCGACGAGGTCGTCACCTCGCCCCACGACCCCCCAATTTACAGCAGCAGCATCGAG
CTGGCCTCGGATGGGGACTCGGCCATTATCCCCAAGGGCGCCATCGATCCCGTTTACGAGGCCAAGGCTCGACTG
CTCAACCGCGCCATCCGTGATATGGGCATGGGATGGTATCAATGGCAGCTCTTCGTCGTCGTCGGCTTCGGCTGG
GCCAGCGACAATCTGTGGCCCGTCGTCACCGCCCTCATCTTCACCCCCATCGCTCAGGAATTCCATCCGGACCGG
CCACCGCTCTTTACGCTGGCCCAAAACATCGGCCTCCTCGCCGGCGCCGCCTTTTGGGGCTTCGGCTGTGACGTC
TTCGGACGCAAGCTCGGCTTCAACCTGACGCTGGGCCTCACCGCATTCTGGGGTCTCGTGGCTGCCAGCGCGCCC
AGCTTCGCCGCCATTGGCTTCTTTGCCTGCATGTGGTCGTTTGGCGTCGGAGGCAACCTGCCCGTCGACTCGGCC
GTCTTTCTCGAGTTCCTGCCGCAGAGCCACCAGTACCTGCTGACGGTGCTGTCCATTGACTGGTCCCTGGCCCAG
GTCATTGCCAATCTCATCGCCTGGCCACTCCTTACCAAGTTCACGTGCTCCCAGGAACAGGCCCAGTCGTGCTCA
CGTCGCGACAACATGGGATGGCGGTACTTTACCCTGGCCATGGGCGGCCTGACCCTCATCATGTTCATCACCCGC
TTCGTCTTCTTCACCATTTACGAGTCTCCCAAGTATTTGGTTGGCAAGGGCCGCGACGCTGACGCCGTCCGCGTC
CTGCACGAGGTGGCCCGGCGCAATGGCACGACGGTGACGCTGACGCTGGAGGACCTAAAGGCCTGCGAGCCCGAC
GGCTACGTGGCCCGGACGGACACGTCGGCGGCTGTCAAGAGGTACATGGAAAAGGTGGACACGCAGCACGTCAAG
GCCCTGTTCGCGGGCCGCCGTTTGGCCACGAGCACGGGCCTCATCATGGCCATCTGGGCCCTCATCGGCCTCGGC
TACCCCCTCTACAACGCCTTCCTGCCATTCATCCAGGCCACTCGGGGCGTCCAGTTCCAGGACGGGAGCAACAAC
ATCACGTATCGCAACAGCCTCATCATCGCCGTCCTCGGAGTTCCGGGCGCCATCCTCGGCGGCTTCTTGGTGGAG
CTACCACGCATGGGCCGCAAGGGCACCCTCTCCCTCTTCACCCTCCTCACAGGCGTCTTTCTCTTTTGCTCGACG
ACGGCCGCCAACAGTACCGCCCTTCTCGGCTGGAACTGCGCCTTTAACTTTTGCAGCAACGTCATGTACGCCGTC
CTCTACGGCTACACGCCCGAGATCTTCCCCACGCCCCAGCGCGGCACGGGCAACGCGCTGTGCGCCTCGTGCAAC
CGCGTCTTTGGCATCATGGCTCCCATTGTAGCCATGTTTGCCAACCTGCAGACGGCGGCCCCGGTCTACGGTAGC
GGCGCGCTGTTTCTCTCCGCAGGCGCCCTCGTCTTGTTTCTTCCGTTTGAGTCTCAAGGGAGAGAGGCCCTGTGA
Transcript >Ophcf2|05513
ATGGGTGTTGAGAACGCTGTCGACGAGGTCGTCACCTCGCCCCACGACCCCCCAATTTACAGCAGCAGCATCGAG
CTGGCCTCGGATGGGGACTCGGCCATTATCCCCAAGGGCGCCATCGATCCCGTTTACGAGGCCAAGGCTCGACTG
CTCAACCGCGCCATCCGTGATATGGGCATGGGATGGTATCAATGGCAGCTCTTCGTCGTCGTCGGCTTCGGCTGG
GCCAGCGACAATCTGTGGCCCGTCGTCACCGCCCTCATCTTCACCCCCATCGCTCAGGAATTCCATCCGGACCGG
CCACCGCTCTTTACGCTGGCCCAAAACATCGGCCTCCTCGCCGGCGCCGCCTTTTGGGGCTTCGGCTGTGACGTC
TTCGGACGCAAGCTCGGCTTCAACCTGACGCTGGGCCTCACCGCATTCTGGGGTCTCGTGGCTGCCAGCGCGCCC
AGCTTCGCCGCCATTGGCTTCTTTGCCTGCATGTGGTCGTTTGGCGTCGGAGGCAACCTGCCCGTCGACTCGGCC
GTCTTTCTCGAGTTCCTGCCGCAGAGCCACCAGTACCTGCTGACGGTGCTGTCCATTGACTGGTCCCTGGCCCAG
GTCATTGCCAATCTCATCGCCTGGCCACTCCTTACCAAGTTCACGTGCTCCCAGGAACAGGCCCAGTCGTGCTCA
CGTCGCGACAACATGGGATGGCGGTACTTTACCCTGGCCATGGGCGGCCTGACCCTCATCATGTTCATCACCCGC
TTCGTCTTCTTCACCATTTACGAGTCTCCCAAGTATTTGGTTGGCAAGGGCCGCGACGCTGACGCCGTCCGCGTC
CTGCACGAGGTGGCCCGGCGCAATGGCACGACGGTGACGCTGACGCTGGAGGACCTAAAGGCCTGCGAGCCCGAC
GGCTACGTGGCCCGGACGGACACGTCGGCGGCTGTCAAGAGGTACATGGAAAAGGTGGACACGCAGCACGTCAAG
GCCCTGTTCGCGGGCCGCCGTTTGGCCACGAGCACGGGCCTCATCATGGCCATCTGGGCCCTCATCGGCCTCGGC
TACCCCCTCTACAACGCCTTCCTGCCATTCATCCAGGCCACTCGGGGCGTCCAGTTCCAGGACGGGAGCAACAAC
ATCACGTATCGCAACAGCCTCATCATCGCCGTCCTCGGAGTTCCGGGCGCCATCCTCGGCGGCTTCTTGGTGGAG
CTACCACGCATGGGCCGCAAGGGCACCCTCTCCCTCTTCACCCTCCTCACAGGCGTCTTTCTCTTTTGCTCGACG
ACGGCCGCCAACAGTACCGCCCTTCTCGGCTGGAACTGCGCCTTTAACTTTTGCAGCAACGTCATGTACGCCGTC
CTCTACGGCTACACGCCCGAGATCTTCCCCACGCCCCAGCGCGGCACGGGCAACGCGCTGTGCGCCTCGTGCAAC
CGCGTCTTTGGCATCATGGCTCCCATTGTAGCCATGTTTGCCAACCTGCAGACGGCGGCCCCGGTCTACGGTAGC
GGCGCGCTGTTTCTCTCCGCAGGCGCCCTCGTCTTGTTTCTTCCGTTTGAGTCTCAAGGGAGAGAGGCCCTGTGA
Gene >Ophcf2|05513
ATGGGTGTTGAGAACGCTGTCGACGAGGTCGTCACCTCGCCCCACGACCCCCCAATTTACAGCAGCAGCATCGAG
CTGGCCTCGGATGGGGACTCGGCCATTATCCCCAAGGGCGCCATCGATCCCGTTTACGAGGCCAAGGCTCGACTG
CTCAACCGCGCCGTGCGTCTCTTGTTCCCCCCCCCCACGCTCGCCCCGCCATCCCGCCCTCATCCCGCCCCTGCT
GACGGTACCCTTCAGATCCGTGATATGGGCATGGGATGGTATCAATGGCAGCTCTTCGTCGTCGTCGGCTTCGGC
TGGGCCAGCGACAATCTGTGGCCCGTCGTCACCGCCCTCATCTTCACCCCCATCGCTCAGGAATTCCATCCGGAC
CGGCCACCGCTCTTTACGCTGGCCCAAAACATCGGCCTCCTCGCCGGCGCCGCCTTTTGGGGCTTCGGCTGTGAC
GTCTTCGGACGCAAGCTCGGCTTCAACCTGACGCTGGGCCTCACCGCATTCTGGGGTCTCGTGGCTGCCAGCGCG
CCCAGCTTCGCCGCCATTGGCTTCTTTGCCTGCATGTGGTCGTTTGGCGTCGGAGGCAACCTGCCCGTCGACTCG
GCCGTCTTTCTCGAGTTCCTGCCGCAGAGCCACCAGTACCTGCTGACGGTGCTGTCCATTGACTGGTCCCTGGCC
CAGGTCATTGCCAATCTCATCGCCTGGCCACTCCTTACCAAGTTCACGTGCTCCCAGGAACAGGCCCAGTCGTGC
TCACGTCGCGACAACATGGGATGGCGGTACTTTACCCTGGCCATGGGCGGCCTGACCCTCATCATGTTCATCACC
CGCTTCGTCTTCTTCACCATTTACGAGTCTCCCAAGTATTTGGTTGGCAAGGGCCGCGACGCTGACGCCGTCCGC
GTCCTGCACGAGGTGGCCCGGCGCAATGGCACGACGGTGACGCTGACGCTGGAGGACCTAAAGGCCTGCGAGCCC
GACGGCTACGTGGCCCGGACGGACACGTCGGCGGCTGTCAAGAGGTACATGGAAAAGGTGGACACGCAGCACGTC
AAGGCCCTGTTCGCGGGCCGCCGTTTGGCCACGAGCACGGGCCTCATCATGGCCATCTGGGCCCTCATCGGCCTC
GGCTACCCCCTCTACAACGCCTTCCTGCCATTCATCCAGGCCACTCGGGGCGTCCAGTTCCAGGACGGGAGCAAC
AACATCACGTATCGCAACAGCCTCATCATCGCCGTCCTCGGAGTTCCGGGCGCCATCCTCGGCGGCTTCTTGGTG
GAGCTACCACGCATGGGCCGCAAGGGCACCCTCTCCCTCTTCACCCTCCTCACAGGCGTCTTTCTCTTTTGCTCG
ACGACGGCCGCCAACAGTACCGCCCTTCTCGGCTGGAACTGCGCCTTTAACTTTTGCAGCAACGTCATGTACGCC
GTCCTCTACGGCTACACGCCCGAGATCTTCCCCACGCCCCAGCGCGGCACGGGCAACGCGCTGTGCGCCTCGTGC
AACCGCGTCTTTGGCATCATGGCTGTGAGTCGCCGCGTCTTGGAATGACGGGAGACAGTTGAGAGACTGACAATT
CTTCCCCTTCCAGCCCATTGTAGCCATGTTTGCCAACCTGCAGACGGCGGCCCCGGTCTACGGTAGCGGCGCGCT
GTTTCTCTCCGCAGGCGCCCTCGTCTTGTTTCTTCCGTTTGAGTCTCAAGGGAGAGAGGCCCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail