Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05506
Gene name
Locationscaffold_06:400713..402257
Strand-
Gene length (bp)1544
Transcript length (bp)1389
Coding sequence length (bp)1389
Protein length (aa) 463

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01148 CTP_transf_1 Cytidylyltransferase family 3.1E-79 76 406

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 89 111 22
2 132 154 22
3 169 188 19
4 201 220 19
5 230 252 22
6 265 287 22
7 343 365 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05506
MGRSSAKRGVRFPHGAAVNGQPSGSDGRRSSFSGSDEGSGSPSRTRSKAQAQLAPVQEKQAASEDEYQKKKQNFI
TRTFWTFSMLAMFFTALFMGHIYIIAIVTAVQIVSFKEVIAISNVPSRARSIRSTKSINWYWLATTMYFLYGESV
IYYFKHVVLVDRVLLPLGIHHRFISFILYVFGFVCFVGTLKAGNYKFQFTNFAWTHMALYLIVVQAHFVMNNIFE
GMIWFFLPAALVIVNDIFAYICGIAFGRTQLIKLSPKKTVEGFVGAWVMTVVFASLLVSLMIRSKYFICPVNDLG
ANIFTGLECEPNPVFLPHTYNLPHLFFLPANTTFSLTFAPMQLHAFALATFASLIAPFGGFFASGLKRTFKIKDF
GDSIPGHGGMTDRMDCQFIMGFFAYMYYHTFVEVHKVTMGSVLEKAITSLSPDEQVELVKSMARYLGNQGVVSEK
VVSCIDDAMAKR*
Coding >Ophcf2|05506
ATGGGCCGGTCTTCCGCAAAGAGGGGCGTCCGCTTCCCCCACGGCGCCGCCGTCAACGGACAGCCCTCGGGATCC
GATGGTCGCCGCTCCAGCTTCAGCGGCTCCGATGAGGGATCCGGCTCGCCGTCGAGGACCCGCTCCAAGGCCCAG
GCTCAGCTGGCTCCCGTTCAAGAGAAGCAGGCCGCATCGGAAGACGAGTACCAGAAGAAGAAGCAGAATTTCATC
ACACGCACCTTTTGGACCTTTAGCATGCTCGCCATGTTCTTCACCGCCCTCTTCATGGGTCACATCTACATCATA
GCCATCGTCACCGCCGTCCAGATTGTTTCCTTCAAAGAGGTCATCGCCATCTCCAACGTGCCCAGTCGCGCCCGT
TCGATCCGGTCGACCAAGAGTATCAACTGGTATTGGCTGGCCACCACCATGTACTTTCTCTACGGCGAGAGTGTC
ATCTACTACTTCAAGCATGTTGTTCTCGTTGACAGGGTGTTGCTGCCTCTCGGTATTCATCACCGCTTCATCAGC
TTCATCCTCTACGTCTTCGGCTTTGTCTGCTTCGTCGGCACTTTAAAAGCCGGAAACTACAAGTTCCAATTCACA
AATTTCGCCTGGACTCACATGGCGCTCTACCTCATCGTCGTCCAGGCTCACTTTGTCATGAACAACATCTTTGAG
GGCATGATCTGGTTCTTCTTACCGGCCGCTCTCGTCATTGTCAACGACATCTTCGCCTACATCTGCGGCATCGCC
TTTGGCCGCACCCAGCTCATCAAGTTGTCGCCCAAGAAGACGGTCGAGGGCTTCGTCGGCGCTTGGGTCATGACG
GTCGTCTTCGCCTCGCTTCTAGTCAGCCTCATGATTCGCTCCAAGTATTTCATCTGCCCCGTCAATGACCTGGGA
GCCAACATCTTTACCGGTCTCGAATGCGAGCCGAATCCCGTCTTCCTCCCTCACACCTACAATCTACCGCATCTG
TTCTTTTTACCGGCAAATACGACGTTTTCGCTCACGTTTGCGCCGATGCAGCTTCACGCCTTCGCGCTGGCTACA
TTTGCCTCGCTCATCGCCCCCTTTGGCGGCTTCTTCGCCTCGGGCCTCAAGCGGACCTTTAAGATCAAGGACTTT
GGCGACTCGATCCCCGGCCACGGTGGCATGACGGACCGGATGGACTGCCAGTTCATCATGGGCTTCTTCGCCTAC
ATGTACTACCACACCTTTGTCGAGGTGCACAAGGTGACGATGGGCTCGGTGCTGGAAAAGGCCATTACCAGTCTG
AGCCCTGACGAGCAGGTCGAGCTGGTCAAGAGCATGGCTCGATATCTGGGCAACCAGGGCGTCGTTTCGGAAAAG
GTGGTTAGCTGTATCGACGACGCCATGGCCAAGCGATGA
Transcript >Ophcf2|05506
ATGGGCCGGTCTTCCGCAAAGAGGGGCGTCCGCTTCCCCCACGGCGCCGCCGTCAACGGACAGCCCTCGGGATCC
GATGGTCGCCGCTCCAGCTTCAGCGGCTCCGATGAGGGATCCGGCTCGCCGTCGAGGACCCGCTCCAAGGCCCAG
GCTCAGCTGGCTCCCGTTCAAGAGAAGCAGGCCGCATCGGAAGACGAGTACCAGAAGAAGAAGCAGAATTTCATC
ACACGCACCTTTTGGACCTTTAGCATGCTCGCCATGTTCTTCACCGCCCTCTTCATGGGTCACATCTACATCATA
GCCATCGTCACCGCCGTCCAGATTGTTTCCTTCAAAGAGGTCATCGCCATCTCCAACGTGCCCAGTCGCGCCCGT
TCGATCCGGTCGACCAAGAGTATCAACTGGTATTGGCTGGCCACCACCATGTACTTTCTCTACGGCGAGAGTGTC
ATCTACTACTTCAAGCATGTTGTTCTCGTTGACAGGGTGTTGCTGCCTCTCGGTATTCATCACCGCTTCATCAGC
TTCATCCTCTACGTCTTCGGCTTTGTCTGCTTCGTCGGCACTTTAAAAGCCGGAAACTACAAGTTCCAATTCACA
AATTTCGCCTGGACTCACATGGCGCTCTACCTCATCGTCGTCCAGGCTCACTTTGTCATGAACAACATCTTTGAG
GGCATGATCTGGTTCTTCTTACCGGCCGCTCTCGTCATTGTCAACGACATCTTCGCCTACATCTGCGGCATCGCC
TTTGGCCGCACCCAGCTCATCAAGTTGTCGCCCAAGAAGACGGTCGAGGGCTTCGTCGGCGCTTGGGTCATGACG
GTCGTCTTCGCCTCGCTTCTAGTCAGCCTCATGATTCGCTCCAAGTATTTCATCTGCCCCGTCAATGACCTGGGA
GCCAACATCTTTACCGGTCTCGAATGCGAGCCGAATCCCGTCTTCCTCCCTCACACCTACAATCTACCGCATCTG
TTCTTTTTACCGGCAAATACGACGTTTTCGCTCACGTTTGCGCCGATGCAGCTTCACGCCTTCGCGCTGGCTACA
TTTGCCTCGCTCATCGCCCCCTTTGGCGGCTTCTTCGCCTCGGGCCTCAAGCGGACCTTTAAGATCAAGGACTTT
GGCGACTCGATCCCCGGCCACGGTGGCATGACGGACCGGATGGACTGCCAGTTCATCATGGGCTTCTTCGCCTAC
ATGTACTACCACACCTTTGTCGAGGTGCACAAGGTGACGATGGGCTCGGTGCTGGAAAAGGCCATTACCAGTCTG
AGCCCTGACGAGCAGGTCGAGCTGGTCAAGAGCATGGCTCGATATCTGGGCAACCAGGGCGTCGTTTCGGAAAAG
GTGGTTAGCTGTATCGACGACGCCATGGCCAAGCGATGA
Gene >Ophcf2|05506
ATGGGCCGGTCTTCCGCAAAGAGGGGCGTCCGCTTCCCCCACGGCGCCGCCGTCAACGGACAGCCCTCGGGATCC
GATGGTCGCCGCTCCAGCTTCAGCGGCTCCGATGAGGGATCCGGCTCGCCGTCGAGGACCCGCTCCAAGGCCCAG
GCTCAGCTGGCTCCCGTTCAAGAGGTTGGTAATTTCTGCCTAGCCGTTGCCCGACGCTGACGCTCTTGTCCGCAG
AAGCAGGCCGCATCGGAAGACGAGTACCAGAAGAAGAAGCAGAATTTCATCACACGCACCTTTTGGACCTTTAGC
ATGCTCGCCATGTTCTTCACCGCCCTCTTCATGGGTCACATCTACATCATAGCCATCGTCACCGCCGTCCAGATT
GTTTCCTTCAAAGAGGTCATCGCCATCTCCAACGTGCCCAGTCGCGCCCGTTCGATCCGGTCGACCAAGAGTATC
AACTGGTATTGGCTGGCCACCACCATGTACTTTCTCTACGGCGAGAGTGTCATCTACTACTTCAAGCATGTTGTT
CTCGTTGACAGGGTGTTGCTGCCTCTCGGTATTCATCACCGCTTCATCAGCTTCATCCTCTACGTCTTCGGTCAG
TCCCTCGTTCTCTACTTATGACTCCGGTCTAACACTTGGCAGGCTTTGTCTGCTTCGTCGGCACTTTAAAAGCCG
GAAACTACAAGTTCCAATTCACAAATTTCGCCTGGACTCACATGGCGCTCTACCTCATCGTCGTCCAGGCTCACT
TTGTCATGAACAACATCTTTGAGGGCATGATCTGGTTCTTCTTACCGGCCGCTCTCGTCATTGTCAACGACATCT
TCGCCTACATCTGCGGCATCGCCTTTGGCCGCACCCAGCTCATCAAGTTGTCGCCCAAGAAGACGGTCGAGGGCT
TCGTCGGCGCTTGGGTCATGACGGTCGTCTTCGCCTCGCTTCTAGTCAGCCTCATGATTCGCTCCAAGTATTTCA
TCTGCCCCGTCAATGTGAGTCGTCTCTGCCCCCGTCTTTCGGAGGACGACGTACTGACGCTCCGAGGACAGGACC
TGGGAGCCAACATCTTTACCGGTCTCGAATGCGAGCCGAATCCCGTCTTCCTCCCTCACACCTACAATCTACCGC
ATCTGTTCTTTTTACCGGCAAATACGACGTTTTCGCTCACGTTTGCGCCGATGCAGCTTCACGCCTTCGCGCTGG
CTACATTTGCCTCGCTCATCGCCCCCTTTGGCGGCTTCTTCGCCTCGGGCCTCAAGCGGACCTTTAAGATCAAGG
ACTTTGGCGACTCGATCCCCGGCCACGGTGGCATGACGGACCGGATGGACTGCCAGTTCATCATGGGCTTCTTCG
CCTACATGTACTACCACACCTTTGTCGAGGTGCACAAGGTGACGATGGGCTCGGTGCTGGAAAAGGCCATTACCA
GTCTGAGCCCTGACGAGCAGGTCGAGCTGGTCAAGAGCATGGCTCGATATCTGGGCAACCAGGGCGTCGTTTCGG
AAAAGGTGGTTAGCTGTATCGACGACGCCATGGCCAAGCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail