Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05500
Gene name
Locationscaffold_06:375855..377247
Strand-
Gene length (bp)1392
Transcript length (bp)1164
Coding sequence length (bp)1164
Protein length (aa) 388

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00551 Formyl_trans_N Formyl transferase 4.1E-19 29 210

GO

GO Term Description Terminal node
GO:0016742 hydroxymethyl-, formyl- and related transferase activity Yes
GO:0009058 biosynthetic process Yes
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1612 0.1177 0.086 0.0366 0.9259 0.0416 0.0509 0.0424 0.047 0.0367

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup945
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1634
Ophiocordyceps australis map64 (Brazil) OphauB2|2466
Ophiocordyceps camponoti-floridani Ophcf2|05500 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1150
Ophiocordyceps kimflemingae Ophio5|7734
Ophiocordyceps subramaniannii Hirsu2|6889

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05500
MLLSRARPVAFKHRPSPRRWFRTASDPLRILFCGSDDFSCESLRALHGELGHGRLVEALDVMVLPARRAGRGREH
LREVPCKALADMLQLPLHQRETFTGWKVPAGTNLIVVVSFGLFVPPRILRSTKYGGVNVHPSFLPDLRGPAPLHH
AILRGDRHIGISLQTLDERRFDHGVVLAQTPAPGLSVPPGASIQTVTAMAATEGAQMLVRGLRHGLHLSPHRDAG
WKGAELEGRTPMHAPKVTKADSQIDWATWTTMDDFYRRLRVFSSVWTRVVFSGGQIRRLILQQVEAVPGDEDPVG
VEGTICFEQQDGQDGTTTWERAVRVDRKSGDCAVRLGSGGVWLRFRSAKVEGKDWQDAATVLGPSLSRGVGGNKR
LTTGVGSGVSAR*
Coding >Ophcf2|05500
ATGCTACTATCTCGAGCCCGGCCTGTCGCGTTCAAGCACCGGCCTTCCCCGCGAAGATGGTTCCGGACGGCGTCG
GATCCGCTGAGGATCCTGTTCTGCGGGTCGGACGACTTTAGCTGCGAATCGCTGCGCGCTCTGCACGGTGAGCTC
GGCCATGGCCGTCTCGTTGAGGCTTTGGATGTCATGGTGCTGCCGGCGAGGAGGGCGGGGCGGGGGAGAGAGCAT
CTTCGAGAGGTCCCCTGCAAAGCTCTGGCTGACATGTTGCAACTGCCCCTTCATCAGCGGGAGACTTTTACTGGT
TGGAAGGTGCCGGCGGGGACGAACCTGATTGTCGTGGTATCGTTTGGTCTGTTTGTGCCGCCGAGGATCCTTCGT
TCTACCAAGTACGGGGGCGTCAACGTCCATCCGTCCTTTCTCCCAGACCTTCGCGGACCGGCGCCTCTTCATCAT
GCCATCCTCCGTGGGGATCGTCACATTGGTATTTCTCTACAGACGCTCGATGAGAGGCGCTTCGATCACGGCGTC
GTTCTCGCCCAGACGCCCGCTCCTGGCCTGAGCGTCCCGCCTGGGGCGTCGATCCAGACGGTCACGGCCATGGCG
GCGACAGAGGGCGCGCAGATGCTCGTCCGAGGCTTAAGACATGGCCTGCACCTTTCGCCTCACCGGGATGCTGGC
TGGAAGGGGGCTGAGCTGGAGGGGCGGACGCCGATGCACGCGCCCAAGGTGACCAAGGCCGACAGCCAGATTGAC
TGGGCGACGTGGACGACGATGGACGACTTCTACCGCCGACTTCGTGTCTTTTCTTCCGTGTGGACGCGTGTCGTC
TTCTCAGGGGGTCAGATACGGCGTCTCATCTTGCAGCAGGTGGAGGCGGTGCCTGGAGACGAGGACCCCGTCGGC
GTCGAGGGAACCATCTGCTTCGAGCAACAAGACGGCCAGGACGGGACGACGACATGGGAGAGGGCCGTCAGGGTA
GACCGGAAATCGGGAGACTGTGCCGTCCGACTCGGCTCGGGAGGCGTCTGGCTGCGCTTCAGGAGCGCCAAGGTC
GAGGGCAAGGACTGGCAGGATGCTGCCACGGTGCTCGGCCCTTCACTCTCCAGGGGTGTGGGAGGAAACAAGAGG
TTGACGACGGGTGTGGGCTCGGGTGTGTCTGCTCGCTAA
Transcript >Ophcf2|05500
ATGCTACTATCTCGAGCCCGGCCTGTCGCGTTCAAGCACCGGCCTTCCCCGCGAAGATGGTTCCGGACGGCGTCG
GATCCGCTGAGGATCCTGTTCTGCGGGTCGGACGACTTTAGCTGCGAATCGCTGCGCGCTCTGCACGGTGAGCTC
GGCCATGGCCGTCTCGTTGAGGCTTTGGATGTCATGGTGCTGCCGGCGAGGAGGGCGGGGCGGGGGAGAGAGCAT
CTTCGAGAGGTCCCCTGCAAAGCTCTGGCTGACATGTTGCAACTGCCCCTTCATCAGCGGGAGACTTTTACTGGT
TGGAAGGTGCCGGCGGGGACGAACCTGATTGTCGTGGTATCGTTTGGTCTGTTTGTGCCGCCGAGGATCCTTCGT
TCTACCAAGTACGGGGGCGTCAACGTCCATCCGTCCTTTCTCCCAGACCTTCGCGGACCGGCGCCTCTTCATCAT
GCCATCCTCCGTGGGGATCGTCACATTGGTATTTCTCTACAGACGCTCGATGAGAGGCGCTTCGATCACGGCGTC
GTTCTCGCCCAGACGCCCGCTCCTGGCCTGAGCGTCCCGCCTGGGGCGTCGATCCAGACGGTCACGGCCATGGCG
GCGACAGAGGGCGCGCAGATGCTCGTCCGAGGCTTAAGACATGGCCTGCACCTTTCGCCTCACCGGGATGCTGGC
TGGAAGGGGGCTGAGCTGGAGGGGCGGACGCCGATGCACGCGCCCAAGGTGACCAAGGCCGACAGCCAGATTGAC
TGGGCGACGTGGACGACGATGGACGACTTCTACCGCCGACTTCGTGTCTTTTCTTCCGTGTGGACGCGTGTCGTC
TTCTCAGGGGGTCAGATACGGCGTCTCATCTTGCAGCAGGTGGAGGCGGTGCCTGGAGACGAGGACCCCGTCGGC
GTCGAGGGAACCATCTGCTTCGAGCAACAAGACGGCCAGGACGGGACGACGACATGGGAGAGGGCCGTCAGGGTA
GACCGGAAATCGGGAGACTGTGCCGTCCGACTCGGCTCGGGAGGCGTCTGGCTGCGCTTCAGGAGCGCCAAGGTC
GAGGGCAAGGACTGGCAGGATGCTGCCACGGTGCTCGGCCCTTCACTCTCCAGGGGTGTGGGAGGAAACAAGAGG
TTGACGACGGGTGTGGGCTCGGGTGTGTCTGCTCGCTAA
Gene >Ophcf2|05500
ATGCTACTATCTCGAGCCCGGCCTGTCGCGTTCAAGCACCGGCCTTCCCCGCGAAGATGGTTCCGGACGGCGTCG
GATCCGCTGAGGATCCTGTTCTGCGGGTCGGACGACTTTAGCTGCGAATCGCTGCGCGCTCTGCACGGTGAGCTC
GGCCATGGCCGTCTCGTTGAGGCTTTGGATGTCATGGTGCTGCCGGCGAGGAGGGCGGGGCGGGGGAGAGAGCAT
CTTCGAGAGGGTTGGTCTCTTTTTTTTTTTTTTTTCTTCTTTCTTGGTTTCTTTCTTATGCAGGAACTTATGTTA
TGACTCGATTGCTCATCTGTTTCTCTCTCGACAGTCCCCTGCAAAGCTCTGGCTGACATGTTGCAACTGCCCCTT
CATCAGCGGGAGACTTTTACTGGTTGGAAGGTGATGTTTGCCCAGAAGTTATGCGGCTTTCCCGGATGCTGAGAC
GCCCTCTCGCTGCTTAGGTGCCGGCGGGGACGAACCTGATTGTCGTGGTATCGTTTGGTCTGTTTGTGCCGCCGA
GGATCCTTCGTTCTACCAAGTACGGGGGCGTCAACGTCCATCCGTCCTTTCTCCCAGAGTGAGTCTCCCAGAGTG
AGTCGAAAGGCACATCATCATGGCTCTGAGTCAGAAGTAACGATCTACAGCCTTCGCGGACCGGCGCCTCTTCAT
CATGCCATCCTCCGTGGGGATCGTCACATTGGTATTTCTCTACAGACGCTCGATGAGAGGCGCTTCGATCACGGC
GTCGTTCTCGCCCAGACGCCCGCTCCTGGCCTGAGCGTCCCGCCTGGGGCGTCGATCCAGACGGTCACGGCCATG
GCGGCGACAGAGGGCGCGCAGATGCTCGTCCGAGGCTTAAGACATGGCCTGCACCTTTCGCCTCACCGGGATGCT
GGCTGGAAGGGGGCTGAGCTGGAGGGGCGGACGCCGATGCACGCGCCCAAGGTGACCAAGGCCGACAGCCAGATT
GACTGGGCGACGTGGACGACGATGGACGACTTCTACCGCCGACTTCGTGTCTTTTCTTCCGTGTGGACGCGTGTC
GTCTTCTCAGGGGGTCAGATACGGCGTCTCATCTTGCAGCAGGTGGAGGCGGTGCCTGGAGACGAGGACCCCGTC
GGCGTCGAGGGAACCATCTGCTTCGAGCAACAAGACGGCCAGGACGGGACGACGACATGGGAGAGGGCCGTCAGG
GTAGACCGGAAATCGGGAGACTGTGCCGTCCGACTCGGCTCGGGAGGCGTCTGGCTGCGCTTCAGGAGCGCCAAG
GTCGAGGGCAAGGACTGGCAGGATGCTGCCACGGTGCTCGGCCCTTCACTCTCCAGGGGTGTGGGAGGAAACAAG
AGGTTGACGACGGGTGTGGGCTCGGGTGTGTCTGCTCGCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail