Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05492
Gene name
Locationscaffold_06:338473..339148
Strand+
Gene length (bp)675
Transcript length (bp)549
Coding sequence length (bp)549
Protein length (aa) 183

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04061 ORMDL ORMDL family 6.5E-58 38 172

GO

GO Term Description Terminal node
GO:0005789 endoplasmic reticulum membrane Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0031090 organelle membrane No
GO:0016020 membrane No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 49 71 22
2 127 144 17
3 148 167 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 112.92 59.60 166.23
Alive In ants, during behavior modification 108.79 56.87 160.71
Dead In ants, recently dead 151.56 83.76 219.35

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.889072 no
Alive Dead 0.053811 no
Dead Fungus 0.146347 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05492
MDDTDSGSRRRRSSSILQVYHEPPETLEQISDQAALPNLNANWTNAKGAWTIHIVVIVMLKIFYDVIPGVSNETS
WTLTNMTYMFGSYLMFHYVRGVPFEFNSGAFDNLNMWEQIDNGAQYTPTKKFLLGVPIVLFLLSTHYTHYDLVYF
VINFLAVLGVIIPKLPFSHRMRFGLFSGPPDV*
Coding >Ophcf2|05492
ATGGACGATACAGACAGCGGTTCCCGTAGGAGGAGATCCAGCAGCATCCTTCAGGTCTACCATGAGCCCCCCGAG
ACGCTCGAGCAGATCAGCGACCAGGCGGCGCTGCCCAACCTCAACGCCAACTGGACAAACGCCAAAGGTGCCTGG
ACGATTCACATCGTCGTCATCGTCATGCTCAAAATCTTTTACGACGTGATCCCCGGCGTGTCCAACGAGACGTCG
TGGACGCTCACAAACATGACGTACATGTTCGGCTCCTATCTCATGTTTCACTACGTCCGCGGCGTCCCGTTCGAG
TTCAACAGTGGGGCCTTTGACAACCTCAACATGTGGGAGCAGATCGACAATGGCGCCCAGTACACGCCCACCAAG
AAGTTTCTGCTGGGCGTGCCCATTGTACTGTTTCTGCTGAGCACCCACTACACCCACTACGACCTGGTGTACTTT
GTCATAAACTTTCTCGCCGTCCTGGGTGTCATCATCCCCAAGCTTCCGTTTAGCCACAGGATGCGATTTGGTCTG
TTCTCGGGGCCGCCAGATGTGTAG
Transcript >Ophcf2|05492
ATGGACGATACAGACAGCGGTTCCCGTAGGAGGAGATCCAGCAGCATCCTTCAGGTCTACCATGAGCCCCCCGAG
ACGCTCGAGCAGATCAGCGACCAGGCGGCGCTGCCCAACCTCAACGCCAACTGGACAAACGCCAAAGGTGCCTGG
ACGATTCACATCGTCGTCATCGTCATGCTCAAAATCTTTTACGACGTGATCCCCGGCGTGTCCAACGAGACGTCG
TGGACGCTCACAAACATGACGTACATGTTCGGCTCCTATCTCATGTTTCACTACGTCCGCGGCGTCCCGTTCGAG
TTCAACAGTGGGGCCTTTGACAACCTCAACATGTGGGAGCAGATCGACAATGGCGCCCAGTACACGCCCACCAAG
AAGTTTCTGCTGGGCGTGCCCATTGTACTGTTTCTGCTGAGCACCCACTACACCCACTACGACCTGGTGTACTTT
GTCATAAACTTTCTCGCCGTCCTGGGTGTCATCATCCCCAAGCTTCCGTTTAGCCACAGGATGCGATTTGGTCTG
TTCTCGGGGCCGCCAGATGTGTAG
Gene >Ophcf2|05492
ATGGACGATACAGACAGCGGTTCCCGTAGGAGGAGATCCAGCAGCATCCTTCAGGTCTACCATGAGCCCCCCGAG
ACGCTCGAGCAGATCAGCGACCAGGCGGCGCTGCCCAACCTCAACGCCAACTGGACAAACGCCAAAGGTGAGTCG
TCCGGGTCTGACGGGGGAGAGAGGGGCTGGTGGTCGGCTGACTCGCCGGTCGAGGTGCCTGGACGATTCACATCG
TCGTCATCGTCATGCTCAAAATCTTTTACGACGTGATCCCCGGCGTGTCCAACGAGACGTCGTGGACGCTCACAA
ACATGACGTACATGTTCGGCTCCTATCTCATGTTTCACTACGTCCGCGGCGTCCCGTTCGAGTTCAACAGTGGGG
CCTTTGACAACCTCAACATGTGGGAGCAGATCGACAATGGCGCCCAGTACACGCCCACCAAGAAGTTTCTGCTGG
GCGTGCCCATTGTACTGTTTCTGCTGAGCACCCACTACACCCACTACGACCTGGTGTACTTTGTCATAAACTTTC
TCGCCGTCCTGGGTGTCATCATCCCCAAGCTTCCGTTTGTGCGTCGGCCCTGTGATGGATGCCATCCCACGCCGT
GCTGCCTCGCGTGCTGACCGTCGACAGAGCCACAGGATGCGATTTGGTCTGTTCTCGGGGCCGCCAGATGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail