Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05488
Gene name
Locationscaffold_06:326750..327826
Strand-
Gene length (bp)1076
Transcript length (bp)900
Coding sequence length (bp)900
Protein length (aa) 300

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08559 Cut8 Cut8, nuclear proteasome tether protein 1.6E-68 36 264

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0031144 proteasome localization Yes
GO:0071630 nuclear protein quality control by the ubiquitin-proteasome system Yes
GO:0043231 intracellular membrane-bounded organelle No
GO:0043170 macromolecule metabolic process No
GO:0010498 proteasomal protein catabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0044265 cellular macromolecule catabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:0051603 proteolysis involved in protein catabolic process No
GO:0006511 ubiquitin-dependent protein catabolic process No
GO:0043227 membrane-bounded organelle No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0009056 catabolic process No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0044237 cellular metabolic process No
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process No
GO:0051179 localization No
GO:0019941 modification-dependent protein catabolic process No
GO:0031503 protein-containing complex localization No
GO:0006515 protein quality control for misfolded or incompletely synthesized proteins No
GO:0008150 biological_process No
GO:0006508 proteolysis No
GO:0043226 organelle No
GO:1901575 organic substance catabolic process No
GO:0019538 protein metabolic process No
GO:0044248 cellular catabolic process No
GO:0009057 macromolecule catabolic process No
GO:0030163 protein catabolic process No
GO:0043229 intracellular organelle No
GO:0006807 nitrogen compound metabolic process No
GO:0005575 cellular_component No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2516 0.947 0.0938 0.0201 0.0964 0.0015 0.0268 0.0116 0.0093 0.0023

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3848
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1142
Ophiocordyceps australis map64 (Brazil) OphauB2|7217
Ophiocordyceps camponoti-floridani Ophcf2|05488 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4985
Ophiocordyceps kimflemingae Ophio5|4032
Ophiocordyceps subramaniannii Hirsu2|760

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05488
MNVLLSPQPPVFPHQHENYRLSPQPSVSPLHAMAPRKRKADADGDETMSPLSSPAATARPLARPSKRSRVNDVVG
RPLTLPRLLETLDAGQLRAVLQRICDGHPQIGHEVSVGAPRPTVSAALDVLHGYHEKLKAALPYGQSSPEYTYYR
IKEPMVALTDALSDFTPQFLPPAESQATKSLQYLDGATELVHQLPDCDSQAYRHLKDGAYEDLSRAWALVINEAG
KRGGGINLHSGGWDHTLSQHDERSGGRLALAMSAMGSNVGWMASNQPATPVEQPSILNQLISGAYGPAVRVGPW*
Coding >Ophcf2|05488
ATGAATGTGCTGCTCTCGCCTCAGCCGCCAGTCTTTCCTCATCAGCACGAAAACTACCGGCTCTCGCCTCAACCA
TCAGTCTCTCCTCTGCATGCCATGGCACCGCGAAAACGAAAGGCAGACGCCGATGGCGACGAGACCATGTCCCCC
TTGAGCTCACCCGCTGCCACCGCCAGGCCGCTCGCCCGGCCGTCCAAGAGATCGAGGGTCAACGATGTCGTCGGC
CGCCCGCTGACCCTCCCTCGCCTTCTCGAGACGCTCGACGCCGGCCAGCTGCGCGCCGTTCTGCAACGCATCTGC
GATGGCCATCCGCAAATCGGTCACGAGGTCAGCGTCGGCGCACCGCGTCCCACCGTCTCCGCCGCCCTCGACGTC
CTCCACGGGTACCATGAAAAGCTCAAGGCCGCCCTGCCTTACGGCCAGTCCAGCCCCGAATACACATATTACCGC
ATCAAGGAGCCCATGGTGGCCCTCACCGACGCCCTGTCCGACTTTACGCCCCAGTTCCTCCCCCCGGCCGAGAGC
CAGGCGACCAAGTCGCTGCAGTATCTCGACGGCGCCACCGAGCTCGTCCACCAGCTTCCGGACTGCGACTCGCAG
GCGTATCGCCACCTCAAGGACGGTGCCTACGAAGACTTGTCTAGGGCTTGGGCCCTCGTCATCAACGAAGCCGGC
AAGAGGGGCGGCGGCATCAACCTGCACTCGGGCGGCTGGGACCACACGCTGTCGCAACACGACGAACGGTCGGGC
GGTCGGCTGGCGCTGGCCATGTCGGCCATGGGCAGCAATGTCGGCTGGATGGCGTCGAACCAGCCGGCAACCCCC
GTCGAGCAGCCCTCGATCCTCAATCAGCTCATTTCCGGAGCATACGGGCCGGCCGTGCGAGTGGGACCCTGGTAG
Transcript >Ophcf2|05488
ATGAATGTGCTGCTCTCGCCTCAGCCGCCAGTCTTTCCTCATCAGCACGAAAACTACCGGCTCTCGCCTCAACCA
TCAGTCTCTCCTCTGCATGCCATGGCACCGCGAAAACGAAAGGCAGACGCCGATGGCGACGAGACCATGTCCCCC
TTGAGCTCACCCGCTGCCACCGCCAGGCCGCTCGCCCGGCCGTCCAAGAGATCGAGGGTCAACGATGTCGTCGGC
CGCCCGCTGACCCTCCCTCGCCTTCTCGAGACGCTCGACGCCGGCCAGCTGCGCGCCGTTCTGCAACGCATCTGC
GATGGCCATCCGCAAATCGGTCACGAGGTCAGCGTCGGCGCACCGCGTCCCACCGTCTCCGCCGCCCTCGACGTC
CTCCACGGGTACCATGAAAAGCTCAAGGCCGCCCTGCCTTACGGCCAGTCCAGCCCCGAATACACATATTACCGC
ATCAAGGAGCCCATGGTGGCCCTCACCGACGCCCTGTCCGACTTTACGCCCCAGTTCCTCCCCCCGGCCGAGAGC
CAGGCGACCAAGTCGCTGCAGTATCTCGACGGCGCCACCGAGCTCGTCCACCAGCTTCCGGACTGCGACTCGCAG
GCGTATCGCCACCTCAAGGACGGTGCCTACGAAGACTTGTCTAGGGCTTGGGCCCTCGTCATCAACGAAGCCGGC
AAGAGGGGCGGCGGCATCAACCTGCACTCGGGCGGCTGGGACCACACGCTGTCGCAACACGACGAACGGTCGGGC
GGTCGGCTGGCGCTGGCCATGTCGGCCATGGGCAGCAATGTCGGCTGGATGGCGTCGAACCAGCCGGCAACCCCC
GTCGAGCAGCCCTCGATCCTCAATCAGCTCATTTCCGGAGCATACGGGCCGGCCGTGCGAGTGGGACCCTGGTAG
Gene >Ophcf2|05488
ATGAATGTGCTGCTCTCGCCTCAGCCGCCAGTCTTTCCTCATCAGCACGAAAACTACCGGCTCTCGCCTCAACCA
TCAGGTACCTCATTCTCGTTTTCCCCTCTCTGCCCGCTTCTCTCTCTGCCCAAGGTTCCTGCATGCGTAATTGGC
CGGATCCACTGCCCTCGAAACAAAGGCCGCATACGCACTCGGATAACCACCTTGCCTCGTTTGGCCCATCATTCG
CTAATGTCGGAAATTTTTCTTGGCCCTCAGTCTCTCCTCTGCATGCCATGGCACCGCGAAAACGAAAGGCAGACG
CCGATGGCGACGAGACCATGTCCCCCTTGAGCTCACCCGCTGCCACCGCCAGGCCGCTCGCCCGGCCGTCCAAGA
GATCGAGGGTCAACGATGTCGTCGGCCGCCCGCTGACCCTCCCTCGCCTTCTCGAGACGCTCGACGCCGGCCAGC
TGCGCGCCGTTCTGCAACGCATCTGCGATGGCCATCCGCAAATCGGTCACGAGGTCAGCGTCGGCGCACCGCGTC
CCACCGTCTCCGCCGCCCTCGACGTCCTCCACGGGTACCATGAAAAGCTCAAGGCCGCCCTGCCTTACGGCCAGT
CCAGCCCCGAATACACATATTACCGCATCAAGGAGCCCATGGTGGCCCTCACCGACGCCCTGTCCGACTTTACGC
CCCAGTTCCTCCCCCCGGCCGAGAGCCAGGCGACCAAGTCGCTGCAGTATCTCGACGGCGCCACCGAGCTCGTCC
ACCAGCTTCCGGACTGCGACTCGCAGGCGTATCGCCACCTCAAGGACGGTGCCTACGAAGACTTGTCTAGGGCTT
GGGCCCTCGTCATCAACGAAGCCGGCAAGAGGGGCGGCGGCATCAACCTGCACTCGGGCGGCTGGGACCACACGC
TGTCGCAACACGACGAACGGTCGGGCGGTCGGCTGGCGCTGGCCATGTCGGCCATGGGCAGCAATGTCGGCTGGA
TGGCGTCGAACCAGCCGGCAACCCCCGTCGAGCAGCCCTCGATCCTCAATCAGCTCATTTCCGGAGCATACGGGC
CGGCCGTGCGAGTGGGACCCTGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail