Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05484
Gene name
Locationscaffold_06:318677..319239
Strand-
Gene length (bp)562
Transcript length (bp)366
Coding sequence length (bp)366
Protein length (aa) 122

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain 1.4E-12 22 80

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.6749 0.1116 0.0677 0.0436 0.4652 0.026 0.3121 0.0966 0.1029 0.1871

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2516
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1145
Ophiocordyceps australis map64 (Brazil) OphauB2|7220
Ophiocordyceps camponoti-floridani Ophcf2|05484 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4989
Ophiocordyceps kimflemingae Ophio5|7057
Ophiocordyceps subramaniannii Hirsu2|3678

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05484
MAPRFEPKVPVQLDPPKDDPISLEQLAKANGADGETCYVAIKGKVYDVTGNKAYQPGGSYHVFAGKDASRALAKS
STKAEDVSPEWKDLDDKEKGVLDDWITFFSKRYNVVGIVEGATNME*
Coding >Ophcf2|05484
ATGGCCCCTCGTTTCGAGCCCAAAGTCCCTGTCCAGCTGGACCCTCCGAAAGACGATCCTATCTCGCTGGAGCAG
CTGGCCAAAGCCAACGGCGCCGACGGCGAGACTTGCTACGTCGCCATCAAGGGCAAGGTCTACGACGTGACTGGC
AACAAGGCCTACCAGCCCGGCGGCTCCTATCACGTTTTCGCTGGCAAGGATGCGTCCAGGGCATTGGCCAAGTCG
TCGACCAAGGCCGAGGACGTCAGCCCCGAGTGGAAAGATCTCGACGACAAGGAAAAGGGGGTGCTCGACGATTGG
ATCACATTCTTCTCAAAGCGATACAACGTTGTGGGCATCGTCGAGGGCGCAACCAACATGGAATAA
Transcript >Ophcf2|05484
ATGGCCCCTCGTTTCGAGCCCAAAGTCCCTGTCCAGCTGGACCCTCCGAAAGACGATCCTATCTCGCTGGAGCAG
CTGGCCAAAGCCAACGGCGCCGACGGCGAGACTTGCTACGTCGCCATCAAGGGCAAGGTCTACGACGTGACTGGC
AACAAGGCCTACCAGCCCGGCGGCTCCTATCACGTTTTCGCTGGCAAGGATGCGTCCAGGGCATTGGCCAAGTCG
TCGACCAAGGCCGAGGACGTCAGCCCCGAGTGGAAAGATCTCGACGACAAGGAAAAGGGGGTGCTCGACGATTGG
ATCACATTCTTCTCAAAGCGATACAACGTTGTGGGCATCGTCGAGGGCGCAACCAACATGGAATAA
Gene >Ophcf2|05484
ATGGCCCCTCGTTTCGAGCCCAAAGTCCCTGTCCAGCTGGACCCTCCGAAAGACGATCCTATCTCGCTGGAGCAG
CTGGCCAAAGCCAACGGTATGGACCTTGTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTGTCTTGTCTGTGGTT
ACTGACGGGTTTCACTTGAGGCGCCGACGGCGAGACTTGCTACGTCGCCATCAAGGTGAGTCAATCAAGTCTGTC
TCGCGAATCTCTCTCACGAATTGTTGTAGGGCAAGGTCTACGACGTGACTGGCAACAAGGCCTACCAGCCCGGCG
GCTCCTATCACGGTACGTCCCTGGTTGATCCTGAATCATTCTCTTCACACCCGGAAGAGCTTTCATTCATTGGAA
CTTAGTTTTCGCTGGCAAGGATGCGTCCAGGGCATTGGCCAAGTCGTCGACCAAGGCCGAGGACGTCAGCCCCGA
GTGGAAAGATCTCGACGACAAGGAAAAGGGGGTGCTCGACGATTGGATCACATTCTTCTCAAAGCGATACAACGT
TGTGGGCATCGTCGAGGGCGCAACCAACATGGAATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail