Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05479
Gene name
Locationscaffold_06:305865..306450
Strand-
Gene length (bp)585
Transcript length (bp)585
Coding sequence length (bp)585
Protein length (aa) 195

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.6356 0.6662 0.0449 0.1422 0.1341 0.0629 0.0695 0.0652 0.0907 0.0133

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1155
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|364
Ophiocordyceps australis map64 (Brazil) OphauB2|7226
Ophiocordyceps camponoti-floridani Ophcf2|05479 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|334
Ophiocordyceps kimflemingae Ophio5|7411
Ophiocordyceps subramaniannii Hirsu2|1024

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05479
MDRHGEGPLASPEPARDEVRLVEDALQPWPTQPPIEALVGELSMQPEEHDVLRMRRKLARRETGRVARLMARYSN
LTTKPTGIQQPLATLRPADSTESASSIDFGLPDPIAASSSPLGFSFPIDGPAPDIEADEGFCDEAVMAEVAMASQ
PLGSRTLLAFRTSTEAALQCSTVVQKRPRMRRRRDKKPPKPPDP*
Coding >Ophcf2|05479
ATGGACCGCCACGGCGAAGGGCCTCTCGCTTCGCCTGAGCCGGCTCGCGACGAAGTCCGCCTCGTCGAAGACGCC
CTTCAGCCTTGGCCGACGCAGCCGCCCATCGAAGCTCTCGTCGGCGAACTCAGCATGCAGCCAGAGGAGCACGAT
GTGCTGCGAATGCGTCGGAAGCTGGCCCGTCGCGAAACTGGCCGTGTCGCTCGTTTGATGGCGAGATATTCCAAC
TTGACCACCAAGCCGACGGGGATCCAACAGCCTCTTGCCACCCTCCGACCAGCCGACTCGACAGAAAGTGCATCA
TCAATCGACTTTGGTCTTCCCGACCCCATCGCCGCCTCTTCATCACCCCTCGGCTTCTCCTTTCCCATCGATGGA
CCGGCGCCCGATATTGAGGCTGACGAGGGATTCTGCGACGAGGCGGTCATGGCTGAGGTGGCCATGGCTAGCCAA
CCTCTTGGAAGCAGAACTCTGCTCGCCTTTCGCACCTCGACCGAGGCCGCGCTTCAGTGCTCAACCGTCGTTCAG
AAACGGCCCAGGATGCGCAGGAGAAGAGACAAGAAGCCTCCCAAACCACCAGATCCCTGA
Transcript >Ophcf2|05479
ATGGACCGCCACGGCGAAGGGCCTCTCGCTTCGCCTGAGCCGGCTCGCGACGAAGTCCGCCTCGTCGAAGACGCC
CTTCAGCCTTGGCCGACGCAGCCGCCCATCGAAGCTCTCGTCGGCGAACTCAGCATGCAGCCAGAGGAGCACGAT
GTGCTGCGAATGCGTCGGAAGCTGGCCCGTCGCGAAACTGGCCGTGTCGCTCGTTTGATGGCGAGATATTCCAAC
TTGACCACCAAGCCGACGGGGATCCAACAGCCTCTTGCCACCCTCCGACCAGCCGACTCGACAGAAAGTGCATCA
TCAATCGACTTTGGTCTTCCCGACCCCATCGCCGCCTCTTCATCACCCCTCGGCTTCTCCTTTCCCATCGATGGA
CCGGCGCCCGATATTGAGGCTGACGAGGGATTCTGCGACGAGGCGGTCATGGCTGAGGTGGCCATGGCTAGCCAA
CCTCTTGGAAGCAGAACTCTGCTCGCCTTTCGCACCTCGACCGAGGCCGCGCTTCAGTGCTCAACCGTCGTTCAG
AAACGGCCCAGGATGCGCAGGAGAAGAGACAAGAAGCCTCCCAAACCACCAGATCCCTGA
Gene >Ophcf2|05479
ATGGACCGCCACGGCGAAGGGCCTCTCGCTTCGCCTGAGCCGGCTCGCGACGAAGTCCGCCTCGTCGAAGACGCC
CTTCAGCCTTGGCCGACGCAGCCGCCCATCGAAGCTCTCGTCGGCGAACTCAGCATGCAGCCAGAGGAGCACGAT
GTGCTGCGAATGCGTCGGAAGCTGGCCCGTCGCGAAACTGGCCGTGTCGCTCGTTTGATGGCGAGATATTCCAAC
TTGACCACCAAGCCGACGGGGATCCAACAGCCTCTTGCCACCCTCCGACCAGCCGACTCGACAGAAAGTGCATCA
TCAATCGACTTTGGTCTTCCCGACCCCATCGCCGCCTCTTCATCACCCCTCGGCTTCTCCTTTCCCATCGATGGA
CCGGCGCCCGATATTGAGGCTGACGAGGGATTCTGCGACGAGGCGGTCATGGCTGAGGTGGCCATGGCTAGCCAA
CCTCTTGGAAGCAGAACTCTGCTCGCCTTTCGCACCTCGACCGAGGCCGCGCTTCAGTGCTCAACCGTCGTTCAG
AAACGGCCCAGGATGCGCAGGAGAAGAGACAAGAAGCCTCCCAAACCACCAGATCCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail