Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05477
Gene name
Locationscaffold_06:292652..294788
Strand-
Gene length (bp)2136
Transcript length (bp)2136
Coding sequence length (bp)2136
Protein length (aa) 712

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11915 DUF3433 Protein of unknown function (DUF3433) 2.4E-18 209 296
PF11915 DUF3433 Protein of unknown function (DUF3433) 1.3E-18 479 562

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

Domain # Start End Length
1 164 186 22
2 206 228 22
3 279 301 22
4 324 346 22
5 359 376 17
6 445 467 22
7 539 561 22
8 591 613 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 61.26 34.82 87.71
Alive In ants, during behavior modification 28.15 13.99 42.31
Dead In ants, recently dead 19.05 9.78 28.31

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.027418 yes
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05477
MTPIHDEEAYHLSLLQAATPFARNDHNHAAFDVTSALGPLAAQDADFIRKLQAHEASGTLTGGLGRGFSTDRVRV
RGADLLSASSSSASSRRHRLSSLRRPTIRAAGQEEANRSGRIVEVIAEGDIGSLEGGRDSRFHSRPSLPPSRVFY
PQPDWRPVSMKLPYLLFLIIISVGLAVASEMLYRIYNTKQHPLVSFTSAHRLPRIVYLAMRFAPSLCAVSYAVAW
QFLDLDVRRLEAFHQLSRKGGAAAASSVNVDYMTGYTLLRPLSALRRGHHAVALSSLASNLAASLVPTLAVASLV
LHPSWATRVSKPDVEKKLLIDGTWSRLLTCTLIVCAVAGLLLLWLLQSRQSGLQADAQGIAGLASMAVVSHMLMD
FKDLDTATHRDIHHRLRRKRYVLRNSSLAPLDDDETWSGNYDDDNDDDDDDELDTKPPPESPHPLILRPAGWLPF
LVGSASFMALIPAMLFTKANVVVDRVPWIITAGAVAVKLSWTAMETAVRVMEPFYILSRRHAPAKTLLLDYTVQP
FGWLPIQALLNRHFLVFAVGLGSVLSELLTILVSGLAMADGLNLTGKSRPSGLAGLDAGQETATSFLVNLLLSEL
ILAYILIVGVLVFARRRQPFLPRQPNTLASVLAYMHQSKMLYDFVGTESMSGNERERRLAGTGKSYGLGWFRGRD
GLTHCGVDEEELKGRYSHGVDGSQQDQPWRTAWDVL*
Coding >Ophcf2|05477
ATGACGCCCATCCACGACGAAGAAGCCTACCATCTCTCCCTCCTACAAGCCGCAACTCCCTTCGCCCGCAATGAC
CACAACCACGCCGCCTTCGACGTCACCTCCGCCCTCGGTCCCCTCGCCGCCCAAGACGCAGACTTCATCCGTAAG
CTGCAAGCCCACGAGGCCAGCGGGACTCTGACCGGTGGCCTCGGCCGGGGCTTCTCTACCGATCGGGTGCGCGTT
CGGGGCGCCGACTTGCTCTCGGCGTCGTCATCGTCGGCGTCTTCCCGTCGGCATCGGCTCTCTTCTCTTCGGAGA
CCTACCATCCGGGCTGCTGGTCAGGAAGAGGCCAATCGAAGCGGACGCATCGTCGAGGTCATTGCTGAAGGGGAC
ATCGGGAGTCTCGAGGGCGGACGCGATTCTCGCTTCCACAGTCGTCCTTCTCTGCCGCCATCACGCGTCTTCTAT
CCACAGCCGGATTGGAGGCCCGTCTCAATGAAGCTTCCCTACCTGTTATTCCTCATCATCATCTCCGTCGGTCTG
GCCGTTGCGTCCGAGATGCTGTACCGCATTTACAACACGAAGCAGCATCCGCTGGTGAGCTTCACGTCGGCTCAC
CGTCTGCCCAGGATAGTCTACCTGGCCATGAGATTCGCGCCATCGCTGTGTGCCGTCTCGTACGCTGTTGCCTGG
CAGTTTCTTGATCTTGACGTCCGGCGCCTCGAAGCCTTTCATCAGCTGTCGAGGAAAGGTGGTGCTGCAGCCGCG
TCGTCGGTCAACGTCGATTACATGACGGGTTATACGCTGTTGAGGCCGTTGAGCGCGCTGAGACGAGGTCACCAT
GCTGTCGCTTTATCATCGCTGGCTTCTAATTTGGCGGCTTCTCTTGTGCCTACTTTGGCCGTCGCGTCTCTCGTC
CTCCATCCGAGCTGGGCTACCCGCGTCAGTAAGCCCGATGTCGAGAAGAAGCTGTTGATTGATGGCACCTGGTCA
CGTCTCCTGACATGCACATTGATCGTCTGTGCAGTCGCCGGCTTGCTTCTGCTCTGGTTGCTGCAGTCGAGACAG
TCTGGTTTGCAAGCTGATGCTCAGGGCATCGCCGGTCTGGCCAGCATGGCTGTCGTCAGTCATATGCTCATGGAC
TTTAAGGATCTCGACACGGCCACTCATCGGGATATTCATCATCGTCTGAGACGCAAGCGTTATGTCTTACGCAAC
TCGTCTCTGGCGCCTCTCGACGATGACGAGACGTGGAGCGGAAACTATGACGACGACAACGACGACGACGACGAC
GACGAGCTCGACACGAAGCCGCCGCCGGAGAGTCCACATCCTCTGATCCTTCGACCGGCCGGTTGGCTGCCCTTC
CTCGTCGGATCGGCCTCCTTCATGGCCCTGATTCCCGCCATGCTCTTTACTAAAGCCAATGTCGTCGTCGATCGC
GTCCCCTGGATCATCACAGCCGGCGCCGTCGCCGTCAAGCTCTCATGGACCGCCATGGAGACGGCCGTCCGCGTC
ATGGAGCCCTTTTACATACTCTCGCGCCGCCACGCGCCGGCCAAGACTCTGCTGCTCGACTATACCGTCCAACCG
TTCGGCTGGCTCCCCATCCAGGCGCTTCTCAACCGCCATTTTCTCGTCTTTGCCGTCGGGCTTGGCAGCGTGCTG
TCCGAGCTGCTGACCATTCTCGTATCAGGCTTGGCCATGGCCGACGGGCTGAACCTCACTGGCAAATCCCGGCCT
TCCGGGCTGGCGGGTTTGGACGCGGGCCAGGAGACGGCCACGTCCTTTCTGGTGAATTTATTGCTGTCGGAGCTG
ATCCTCGCCTACATCCTCATCGTCGGAGTCCTCGTCTTCGCCCGCCGCCGCCAGCCGTTCCTACCACGGCAGCCC
AACACGCTGGCGTCGGTCCTGGCTTATATGCACCAGAGCAAGATGTTGTACGACTTTGTCGGTACCGAGAGCATG
AGCGGCAACGAGAGAGAACGCAGGCTGGCCGGTACGGGCAAGTCGTACGGGCTCGGCTGGTTCCGGGGCCGCGAC
GGGCTGACGCACTGCGGTGTGGACGAGGAGGAGCTGAAGGGCAGATATAGTCATGGGGTGGACGGATCGCAGCAG
GACCAGCCGTGGAGGACGGCGTGGGACGTGCTGTGA
Transcript >Ophcf2|05477
ATGACGCCCATCCACGACGAAGAAGCCTACCATCTCTCCCTCCTACAAGCCGCAACTCCCTTCGCCCGCAATGAC
CACAACCACGCCGCCTTCGACGTCACCTCCGCCCTCGGTCCCCTCGCCGCCCAAGACGCAGACTTCATCCGTAAG
CTGCAAGCCCACGAGGCCAGCGGGACTCTGACCGGTGGCCTCGGCCGGGGCTTCTCTACCGATCGGGTGCGCGTT
CGGGGCGCCGACTTGCTCTCGGCGTCGTCATCGTCGGCGTCTTCCCGTCGGCATCGGCTCTCTTCTCTTCGGAGA
CCTACCATCCGGGCTGCTGGTCAGGAAGAGGCCAATCGAAGCGGACGCATCGTCGAGGTCATTGCTGAAGGGGAC
ATCGGGAGTCTCGAGGGCGGACGCGATTCTCGCTTCCACAGTCGTCCTTCTCTGCCGCCATCACGCGTCTTCTAT
CCACAGCCGGATTGGAGGCCCGTCTCAATGAAGCTTCCCTACCTGTTATTCCTCATCATCATCTCCGTCGGTCTG
GCCGTTGCGTCCGAGATGCTGTACCGCATTTACAACACGAAGCAGCATCCGCTGGTGAGCTTCACGTCGGCTCAC
CGTCTGCCCAGGATAGTCTACCTGGCCATGAGATTCGCGCCATCGCTGTGTGCCGTCTCGTACGCTGTTGCCTGG
CAGTTTCTTGATCTTGACGTCCGGCGCCTCGAAGCCTTTCATCAGCTGTCGAGGAAAGGTGGTGCTGCAGCCGCG
TCGTCGGTCAACGTCGATTACATGACGGGTTATACGCTGTTGAGGCCGTTGAGCGCGCTGAGACGAGGTCACCAT
GCTGTCGCTTTATCATCGCTGGCTTCTAATTTGGCGGCTTCTCTTGTGCCTACTTTGGCCGTCGCGTCTCTCGTC
CTCCATCCGAGCTGGGCTACCCGCGTCAGTAAGCCCGATGTCGAGAAGAAGCTGTTGATTGATGGCACCTGGTCA
CGTCTCCTGACATGCACATTGATCGTCTGTGCAGTCGCCGGCTTGCTTCTGCTCTGGTTGCTGCAGTCGAGACAG
TCTGGTTTGCAAGCTGATGCTCAGGGCATCGCCGGTCTGGCCAGCATGGCTGTCGTCAGTCATATGCTCATGGAC
TTTAAGGATCTCGACACGGCCACTCATCGGGATATTCATCATCGTCTGAGACGCAAGCGTTATGTCTTACGCAAC
TCGTCTCTGGCGCCTCTCGACGATGACGAGACGTGGAGCGGAAACTATGACGACGACAACGACGACGACGACGAC
GACGAGCTCGACACGAAGCCGCCGCCGGAGAGTCCACATCCTCTGATCCTTCGACCGGCCGGTTGGCTGCCCTTC
CTCGTCGGATCGGCCTCCTTCATGGCCCTGATTCCCGCCATGCTCTTTACTAAAGCCAATGTCGTCGTCGATCGC
GTCCCCTGGATCATCACAGCCGGCGCCGTCGCCGTCAAGCTCTCATGGACCGCCATGGAGACGGCCGTCCGCGTC
ATGGAGCCCTTTTACATACTCTCGCGCCGCCACGCGCCGGCCAAGACTCTGCTGCTCGACTATACCGTCCAACCG
TTCGGCTGGCTCCCCATCCAGGCGCTTCTCAACCGCCATTTTCTCGTCTTTGCCGTCGGGCTTGGCAGCGTGCTG
TCCGAGCTGCTGACCATTCTCGTATCAGGCTTGGCCATGGCCGACGGGCTGAACCTCACTGGCAAATCCCGGCCT
TCCGGGCTGGCGGGTTTGGACGCGGGCCAGGAGACGGCCACGTCCTTTCTGGTGAATTTATTGCTGTCGGAGCTG
ATCCTCGCCTACATCCTCATCGTCGGAGTCCTCGTCTTCGCCCGCCGCCGCCAGCCGTTCCTACCACGGCAGCCC
AACACGCTGGCGTCGGTCCTGGCTTATATGCACCAGAGCAAGATGTTGTACGACTTTGTCGGTACCGAGAGCATG
AGCGGCAACGAGAGAGAACGCAGGCTGGCCGGTACGGGCAAGTCGTACGGGCTCGGCTGGTTCCGGGGCCGCGAC
GGGCTGACGCACTGCGGTGTGGACGAGGAGGAGCTGAAGGGCAGATATAGTCATGGGGTGGACGGATCGCAGCAG
GACCAGCCGTGGAGGACGGCGTGGGACGTGCTGTGA
Gene >Ophcf2|05477
ATGACGCCCATCCACGACGAAGAAGCCTACCATCTCTCCCTCCTACAAGCCGCAACTCCCTTCGCCCGCAATGAC
CACAACCACGCCGCCTTCGACGTCACCTCCGCCCTCGGTCCCCTCGCCGCCCAAGACGCAGACTTCATCCGTAAG
CTGCAAGCCCACGAGGCCAGCGGGACTCTGACCGGTGGCCTCGGCCGGGGCTTCTCTACCGATCGGGTGCGCGTT
CGGGGCGCCGACTTGCTCTCGGCGTCGTCATCGTCGGCGTCTTCCCGTCGGCATCGGCTCTCTTCTCTTCGGAGA
CCTACCATCCGGGCTGCTGGTCAGGAAGAGGCCAATCGAAGCGGACGCATCGTCGAGGTCATTGCTGAAGGGGAC
ATCGGGAGTCTCGAGGGCGGACGCGATTCTCGCTTCCACAGTCGTCCTTCTCTGCCGCCATCACGCGTCTTCTAT
CCACAGCCGGATTGGAGGCCCGTCTCAATGAAGCTTCCCTACCTGTTATTCCTCATCATCATCTCCGTCGGTCTG
GCCGTTGCGTCCGAGATGCTGTACCGCATTTACAACACGAAGCAGCATCCGCTGGTGAGCTTCACGTCGGCTCAC
CGTCTGCCCAGGATAGTCTACCTGGCCATGAGATTCGCGCCATCGCTGTGTGCCGTCTCGTACGCTGTTGCCTGG
CAGTTTCTTGATCTTGACGTCCGGCGCCTCGAAGCCTTTCATCAGCTGTCGAGGAAAGGTGGTGCTGCAGCCGCG
TCGTCGGTCAACGTCGATTACATGACGGGTTATACGCTGTTGAGGCCGTTGAGCGCGCTGAGACGAGGTCACCAT
GCTGTCGCTTTATCATCGCTGGCTTCTAATTTGGCGGCTTCTCTTGTGCCTACTTTGGCCGTCGCGTCTCTCGTC
CTCCATCCGAGCTGGGCTACCCGCGTCAGTAAGCCCGATGTCGAGAAGAAGCTGTTGATTGATGGCACCTGGTCA
CGTCTCCTGACATGCACATTGATCGTCTGTGCAGTCGCCGGCTTGCTTCTGCTCTGGTTGCTGCAGTCGAGACAG
TCTGGTTTGCAAGCTGATGCTCAGGGCATCGCCGGTCTGGCCAGCATGGCTGTCGTCAGTCATATGCTCATGGAC
TTTAAGGATCTCGACACGGCCACTCATCGGGATATTCATCATCGTCTGAGACGCAAGCGTTATGTCTTACGCAAC
TCGTCTCTGGCGCCTCTCGACGATGACGAGACGTGGAGCGGAAACTATGACGACGACAACGACGACGACGACGAC
GACGAGCTCGACACGAAGCCGCCGCCGGAGAGTCCACATCCTCTGATCCTTCGACCGGCCGGTTGGCTGCCCTTC
CTCGTCGGATCGGCCTCCTTCATGGCCCTGATTCCCGCCATGCTCTTTACTAAAGCCAATGTCGTCGTCGATCGC
GTCCCCTGGATCATCACAGCCGGCGCCGTCGCCGTCAAGCTCTCATGGACCGCCATGGAGACGGCCGTCCGCGTC
ATGGAGCCCTTTTACATACTCTCGCGCCGCCACGCGCCGGCCAAGACTCTGCTGCTCGACTATACCGTCCAACCG
TTCGGCTGGCTCCCCATCCAGGCGCTTCTCAACCGCCATTTTCTCGTCTTTGCCGTCGGGCTTGGCAGCGTGCTG
TCCGAGCTGCTGACCATTCTCGTATCAGGCTTGGCCATGGCCGACGGGCTGAACCTCACTGGCAAATCCCGGCCT
TCCGGGCTGGCGGGTTTGGACGCGGGCCAGGAGACGGCCACGTCCTTTCTGGTGAATTTATTGCTGTCGGAGCTG
ATCCTCGCCTACATCCTCATCGTCGGAGTCCTCGTCTTCGCCCGCCGCCGCCAGCCGTTCCTACCACGGCAGCCC
AACACGCTGGCGTCGGTCCTGGCTTATATGCACCAGAGCAAGATGTTGTACGACTTTGTCGGTACCGAGAGCATG
AGCGGCAACGAGAGAGAACGCAGGCTGGCCGGTACGGGCAAGTCGTACGGGCTCGGCTGGTTCCGGGGCCGCGAC
GGGCTGACGCACTGCGGTGTGGACGAGGAGGAGCTGAAGGGCAGATATAGTCATGGGGTGGACGGATCGCAGCAG
GACCAGCCGTGGAGGACGGCGTGGGACGTGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail