Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05477
Gene name
Locationscaffold_06:292652..294788
Strand-
Gene length (bp)2136
Transcript length (bp)2136
Coding sequence length (bp)2136
Protein length (aa) 712

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11915 DUF3433 Protein of unknown function (DUF3433) 2.4E-18 209 296
PF11915 DUF3433 Protein of unknown function (DUF3433) 1.3E-18 479 562

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

Domain # Start End Length
1 164 186 22
2 206 228 22
3 279 301 22
4 324 346 22
5 359 376 17
6 445 467 22
7 539 561 22
8 591 613 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05477
MTPIHDEEAYHLSLLQAATPFARNDHNHAAFDVTSALGPLAAQDADFIRKLQAHEASGTLTGGLGRGFSTDRVRV
RGADLLSASSSSASSRRHRLSSLRRPTIRAAGQEEANRSGRIVEVIAEGDIGSLEGGRDSRFHSRPSLPPSRVFY
PQPDWRPVSMKLPYLLFLIIISVGLAVASEMLYRIYNTKQHPLVSFTSAHRLPRIVYLAMRFAPSLCAVSYAVAW
QFLDLDVRRLEAFHQLSRKGGAAAASSVNVDYMTGYTLLRPLSALRRGHHAVALSSLASNLAASLVPTLAVASLV
LHPSWATRVSKPDVEKKLLIDGTWSRLLTCTLIVCAVAGLLLLWLLQSRQSGLQADAQGIAGLASMAVVSHMLMD
FKDLDTATHRDIHHRLRRKRYVLRNSSLAPLDDDETWSGNYDDDNDDDDDDELDTKPPPESPHPLILRPAGWLPF
LVGSASFMALIPAMLFTKANVVVDRVPWIITAGAVAVKLSWTAMETAVRVMEPFYILSRRHAPAKTLLLDYTVQP
FGWLPIQALLNRHFLVFAVGLGSVLSELLTILVSGLAMADGLNLTGKSRPSGLAGLDAGQETATSFLVNLLLSEL
ILAYILIVGVLVFARRRQPFLPRQPNTLASVLAYMHQSKMLYDFVGTESMSGNERERRLAGTGKSYGLGWFRGRD
GLTHCGVDEEELKGRYSHGVDGSQQDQPWRTAWDVL*
Coding >Ophcf2|05477
ATGACGCCCATCCACGACGAAGAAGCCTACCATCTCTCCCTCCTACAAGCCGCAACTCCCTTCGCCCGCAATGAC
CACAACCACGCCGCCTTCGACGTCACCTCCGCCCTCGGTCCCCTCGCCGCCCAAGACGCAGACTTCATCCGTAAG
CTGCAAGCCCACGAGGCCAGCGGGACTCTGACCGGTGGCCTCGGCCGGGGCTTCTCTACCGATCGGGTGCGCGTT
CGGGGCGCCGACTTGCTCTCGGCGTCGTCATCGTCGGCGTCTTCCCGTCGGCATCGGCTCTCTTCTCTTCGGAGA
CCTACCATCCGGGCTGCTGGTCAGGAAGAGGCCAATCGAAGCGGACGCATCGTCGAGGTCATTGCTGAAGGGGAC
ATCGGGAGTCTCGAGGGCGGACGCGATTCTCGCTTCCACAGTCGTCCTTCTCTGCCGCCATCACGCGTCTTCTAT
CCACAGCCGGATTGGAGGCCCGTCTCAATGAAGCTTCCCTACCTGTTATTCCTCATCATCATCTCCGTCGGTCTG
GCCGTTGCGTCCGAGATGCTGTACCGCATTTACAACACGAAGCAGCATCCGCTGGTGAGCTTCACGTCGGCTCAC
CGTCTGCCCAGGATAGTCTACCTGGCCATGAGATTCGCGCCATCGCTGTGTGCCGTCTCGTACGCTGTTGCCTGG
CAGTTTCTTGATCTTGACGTCCGGCGCCTCGAAGCCTTTCATCAGCTGTCGAGGAAAGGTGGTGCTGCAGCCGCG
TCGTCGGTCAACGTCGATTACATGACGGGTTATACGCTGTTGAGGCCGTTGAGCGCGCTGAGACGAGGTCACCAT
GCTGTCGCTTTATCATCGCTGGCTTCTAATTTGGCGGCTTCTCTTGTGCCTACTTTGGCCGTCGCGTCTCTCGTC
CTCCATCCGAGCTGGGCTACCCGCGTCAGTAAGCCCGATGTCGAGAAGAAGCTGTTGATTGATGGCACCTGGTCA
CGTCTCCTGACATGCACATTGATCGTCTGTGCAGTCGCCGGCTTGCTTCTGCTCTGGTTGCTGCAGTCGAGACAG
TCTGGTTTGCAAGCTGATGCTCAGGGCATCGCCGGTCTGGCCAGCATGGCTGTCGTCAGTCATATGCTCATGGAC
TTTAAGGATCTCGACACGGCCACTCATCGGGATATTCATCATCGTCTGAGACGCAAGCGTTATGTCTTACGCAAC
TCGTCTCTGGCGCCTCTCGACGATGACGAGACGTGGAGCGGAAACTATGACGACGACAACGACGACGACGACGAC
GACGAGCTCGACACGAAGCCGCCGCCGGAGAGTCCACATCCTCTGATCCTTCGACCGGCCGGTTGGCTGCCCTTC
CTCGTCGGATCGGCCTCCTTCATGGCCCTGATTCCCGCCATGCTCTTTACTAAAGCCAATGTCGTCGTCGATCGC
GTCCCCTGGATCATCACAGCCGGCGCCGTCGCCGTCAAGCTCTCATGGACCGCCATGGAGACGGCCGTCCGCGTC
ATGGAGCCCTTTTACATACTCTCGCGCCGCCACGCGCCGGCCAAGACTCTGCTGCTCGACTATACCGTCCAACCG
TTCGGCTGGCTCCCCATCCAGGCGCTTCTCAACCGCCATTTTCTCGTCTTTGCCGTCGGGCTTGGCAGCGTGCTG
TCCGAGCTGCTGACCATTCTCGTATCAGGCTTGGCCATGGCCGACGGGCTGAACCTCACTGGCAAATCCCGGCCT
TCCGGGCTGGCGGGTTTGGACGCGGGCCAGGAGACGGCCACGTCCTTTCTGGTGAATTTATTGCTGTCGGAGCTG
ATCCTCGCCTACATCCTCATCGTCGGAGTCCTCGTCTTCGCCCGCCGCCGCCAGCCGTTCCTACCACGGCAGCCC
AACACGCTGGCGTCGGTCCTGGCTTATATGCACCAGAGCAAGATGTTGTACGACTTTGTCGGTACCGAGAGCATG
AGCGGCAACGAGAGAGAACGCAGGCTGGCCGGTACGGGCAAGTCGTACGGGCTCGGCTGGTTCCGGGGCCGCGAC
GGGCTGACGCACTGCGGTGTGGACGAGGAGGAGCTGAAGGGCAGATATAGTCATGGGGTGGACGGATCGCAGCAG
GACCAGCCGTGGAGGACGGCGTGGGACGTGCTGTGA
Transcript >Ophcf2|05477
ATGACGCCCATCCACGACGAAGAAGCCTACCATCTCTCCCTCCTACAAGCCGCAACTCCCTTCGCCCGCAATGAC
CACAACCACGCCGCCTTCGACGTCACCTCCGCCCTCGGTCCCCTCGCCGCCCAAGACGCAGACTTCATCCGTAAG
CTGCAAGCCCACGAGGCCAGCGGGACTCTGACCGGTGGCCTCGGCCGGGGCTTCTCTACCGATCGGGTGCGCGTT
CGGGGCGCCGACTTGCTCTCGGCGTCGTCATCGTCGGCGTCTTCCCGTCGGCATCGGCTCTCTTCTCTTCGGAGA
CCTACCATCCGGGCTGCTGGTCAGGAAGAGGCCAATCGAAGCGGACGCATCGTCGAGGTCATTGCTGAAGGGGAC
ATCGGGAGTCTCGAGGGCGGACGCGATTCTCGCTTCCACAGTCGTCCTTCTCTGCCGCCATCACGCGTCTTCTAT
CCACAGCCGGATTGGAGGCCCGTCTCAATGAAGCTTCCCTACCTGTTATTCCTCATCATCATCTCCGTCGGTCTG
GCCGTTGCGTCCGAGATGCTGTACCGCATTTACAACACGAAGCAGCATCCGCTGGTGAGCTTCACGTCGGCTCAC
CGTCTGCCCAGGATAGTCTACCTGGCCATGAGATTCGCGCCATCGCTGTGTGCCGTCTCGTACGCTGTTGCCTGG
CAGTTTCTTGATCTTGACGTCCGGCGCCTCGAAGCCTTTCATCAGCTGTCGAGGAAAGGTGGTGCTGCAGCCGCG
TCGTCGGTCAACGTCGATTACATGACGGGTTATACGCTGTTGAGGCCGTTGAGCGCGCTGAGACGAGGTCACCAT
GCTGTCGCTTTATCATCGCTGGCTTCTAATTTGGCGGCTTCTCTTGTGCCTACTTTGGCCGTCGCGTCTCTCGTC
CTCCATCCGAGCTGGGCTACCCGCGTCAGTAAGCCCGATGTCGAGAAGAAGCTGTTGATTGATGGCACCTGGTCA
CGTCTCCTGACATGCACATTGATCGTCTGTGCAGTCGCCGGCTTGCTTCTGCTCTGGTTGCTGCAGTCGAGACAG
TCTGGTTTGCAAGCTGATGCTCAGGGCATCGCCGGTCTGGCCAGCATGGCTGTCGTCAGTCATATGCTCATGGAC
TTTAAGGATCTCGACACGGCCACTCATCGGGATATTCATCATCGTCTGAGACGCAAGCGTTATGTCTTACGCAAC
TCGTCTCTGGCGCCTCTCGACGATGACGAGACGTGGAGCGGAAACTATGACGACGACAACGACGACGACGACGAC
GACGAGCTCGACACGAAGCCGCCGCCGGAGAGTCCACATCCTCTGATCCTTCGACCGGCCGGTTGGCTGCCCTTC
CTCGTCGGATCGGCCTCCTTCATGGCCCTGATTCCCGCCATGCTCTTTACTAAAGCCAATGTCGTCGTCGATCGC
GTCCCCTGGATCATCACAGCCGGCGCCGTCGCCGTCAAGCTCTCATGGACCGCCATGGAGACGGCCGTCCGCGTC
ATGGAGCCCTTTTACATACTCTCGCGCCGCCACGCGCCGGCCAAGACTCTGCTGCTCGACTATACCGTCCAACCG
TTCGGCTGGCTCCCCATCCAGGCGCTTCTCAACCGCCATTTTCTCGTCTTTGCCGTCGGGCTTGGCAGCGTGCTG
TCCGAGCTGCTGACCATTCTCGTATCAGGCTTGGCCATGGCCGACGGGCTGAACCTCACTGGCAAATCCCGGCCT
TCCGGGCTGGCGGGTTTGGACGCGGGCCAGGAGACGGCCACGTCCTTTCTGGTGAATTTATTGCTGTCGGAGCTG
ATCCTCGCCTACATCCTCATCGTCGGAGTCCTCGTCTTCGCCCGCCGCCGCCAGCCGTTCCTACCACGGCAGCCC
AACACGCTGGCGTCGGTCCTGGCTTATATGCACCAGAGCAAGATGTTGTACGACTTTGTCGGTACCGAGAGCATG
AGCGGCAACGAGAGAGAACGCAGGCTGGCCGGTACGGGCAAGTCGTACGGGCTCGGCTGGTTCCGGGGCCGCGAC
GGGCTGACGCACTGCGGTGTGGACGAGGAGGAGCTGAAGGGCAGATATAGTCATGGGGTGGACGGATCGCAGCAG
GACCAGCCGTGGAGGACGGCGTGGGACGTGCTGTGA
Gene >Ophcf2|05477
ATGACGCCCATCCACGACGAAGAAGCCTACCATCTCTCCCTCCTACAAGCCGCAACTCCCTTCGCCCGCAATGAC
CACAACCACGCCGCCTTCGACGTCACCTCCGCCCTCGGTCCCCTCGCCGCCCAAGACGCAGACTTCATCCGTAAG
CTGCAAGCCCACGAGGCCAGCGGGACTCTGACCGGTGGCCTCGGCCGGGGCTTCTCTACCGATCGGGTGCGCGTT
CGGGGCGCCGACTTGCTCTCGGCGTCGTCATCGTCGGCGTCTTCCCGTCGGCATCGGCTCTCTTCTCTTCGGAGA
CCTACCATCCGGGCTGCTGGTCAGGAAGAGGCCAATCGAAGCGGACGCATCGTCGAGGTCATTGCTGAAGGGGAC
ATCGGGAGTCTCGAGGGCGGACGCGATTCTCGCTTCCACAGTCGTCCTTCTCTGCCGCCATCACGCGTCTTCTAT
CCACAGCCGGATTGGAGGCCCGTCTCAATGAAGCTTCCCTACCTGTTATTCCTCATCATCATCTCCGTCGGTCTG
GCCGTTGCGTCCGAGATGCTGTACCGCATTTACAACACGAAGCAGCATCCGCTGGTGAGCTTCACGTCGGCTCAC
CGTCTGCCCAGGATAGTCTACCTGGCCATGAGATTCGCGCCATCGCTGTGTGCCGTCTCGTACGCTGTTGCCTGG
CAGTTTCTTGATCTTGACGTCCGGCGCCTCGAAGCCTTTCATCAGCTGTCGAGGAAAGGTGGTGCTGCAGCCGCG
TCGTCGGTCAACGTCGATTACATGACGGGTTATACGCTGTTGAGGCCGTTGAGCGCGCTGAGACGAGGTCACCAT
GCTGTCGCTTTATCATCGCTGGCTTCTAATTTGGCGGCTTCTCTTGTGCCTACTTTGGCCGTCGCGTCTCTCGTC
CTCCATCCGAGCTGGGCTACCCGCGTCAGTAAGCCCGATGTCGAGAAGAAGCTGTTGATTGATGGCACCTGGTCA
CGTCTCCTGACATGCACATTGATCGTCTGTGCAGTCGCCGGCTTGCTTCTGCTCTGGTTGCTGCAGTCGAGACAG
TCTGGTTTGCAAGCTGATGCTCAGGGCATCGCCGGTCTGGCCAGCATGGCTGTCGTCAGTCATATGCTCATGGAC
TTTAAGGATCTCGACACGGCCACTCATCGGGATATTCATCATCGTCTGAGACGCAAGCGTTATGTCTTACGCAAC
TCGTCTCTGGCGCCTCTCGACGATGACGAGACGTGGAGCGGAAACTATGACGACGACAACGACGACGACGACGAC
GACGAGCTCGACACGAAGCCGCCGCCGGAGAGTCCACATCCTCTGATCCTTCGACCGGCCGGTTGGCTGCCCTTC
CTCGTCGGATCGGCCTCCTTCATGGCCCTGATTCCCGCCATGCTCTTTACTAAAGCCAATGTCGTCGTCGATCGC
GTCCCCTGGATCATCACAGCCGGCGCCGTCGCCGTCAAGCTCTCATGGACCGCCATGGAGACGGCCGTCCGCGTC
ATGGAGCCCTTTTACATACTCTCGCGCCGCCACGCGCCGGCCAAGACTCTGCTGCTCGACTATACCGTCCAACCG
TTCGGCTGGCTCCCCATCCAGGCGCTTCTCAACCGCCATTTTCTCGTCTTTGCCGTCGGGCTTGGCAGCGTGCTG
TCCGAGCTGCTGACCATTCTCGTATCAGGCTTGGCCATGGCCGACGGGCTGAACCTCACTGGCAAATCCCGGCCT
TCCGGGCTGGCGGGTTTGGACGCGGGCCAGGAGACGGCCACGTCCTTTCTGGTGAATTTATTGCTGTCGGAGCTG
ATCCTCGCCTACATCCTCATCGTCGGAGTCCTCGTCTTCGCCCGCCGCCGCCAGCCGTTCCTACCACGGCAGCCC
AACACGCTGGCGTCGGTCCTGGCTTATATGCACCAGAGCAAGATGTTGTACGACTTTGTCGGTACCGAGAGCATG
AGCGGCAACGAGAGAGAACGCAGGCTGGCCGGTACGGGCAAGTCGTACGGGCTCGGCTGGTTCCGGGGCCGCGAC
GGGCTGACGCACTGCGGTGTGGACGAGGAGGAGCTGAAGGGCAGATATAGTCATGGGGTGGACGGATCGCAGCAG
GACCAGCCGTGGAGGACGGCGTGGGACGTGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail