Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05476
Gene name
Locationscaffold_06:286002..291084
Strand-
Gene length (bp)5082
Transcript length (bp)3990
Coding sequence length (bp)3990
Protein length (aa) 1330

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06011 TRP Transient receptor potential (TRP) ion channel 1.6E-162 167 617
PF07103 DUF1365 Protein of unknown function (DUF1365) 2.1E-62 836 1095
PF14558 TRP_N ML-like domain 9.4E-42 26 162

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 341 363 22
2 384 406 22
3 421 443 22
4 479 501 22
5 506 528 22
6 537 559 22
7 569 591 22
8 761 778 17
9 798 820 22
10 851 873 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05476
MRWSLLRAPLLAVASMASLATGEKLLMSSSLNTCQQDSSFSASLFNVVYTPNNNSASINIVATSSVQGKVIFDLA
ISAYGYQFLRMTLNPCDMDLAGLCPMVAGKIPFGFNLPVGKDAAQRIPNIAYNIPDLDATVRVYVNLTATGESVA
CVEADISNGKTVDLIGVKWATAIIAGLALIASAVVNGLGHSNTAAHVAANSLSLFGYFQAQAIVGLTSVPLPPIV
QSWTQDFQWSMGIIRVGFMQDIFTWYQRATGGTPSTIFDSLTTVSVQVAKRSLEYADASLSLFKRGAAMMPRAVT
AAAHGLVRRNNITTGSGAYIVFGIQRVAFRSKIETTNLFMTGLTFFCIFVVLTVLSVAAFKGICELSVKNKWMDK
DKFLDFRNGWLTVLKGILFRVALIGFPQMAILCLWEFTQVDSPAEVVLAVFFFFGMALTLAWGAAKVIRIARRSV
AMHRNPAYILFSDPQALNKWGFLYIQFRASAYYFIAPVLGYTLIKAMFVAFSQRNAVAQAVGFVIIEAAALIAAS
VLRPWMDKSTNSFNIAICVVNFLNAIFLLIFSNVFGAPSLVVGVVGVVLFVLNAAFSLILLIMVIVSTTVTFFRK
NPDARYQVMADDRASFMKSQTQLTTTTELDALAATARGDKAGYKVHLDLDDDNESLASEDLRRRGVPDPNGSHSS
QASFHNAQQQHHASPPPVNPSMPLFPAGGPRSQSPFRSPSPSSYTRSGSSLGQQRPQGATSPAGYRAQNSPSPWQ
RGAGYDKAVDGLLYALLLLLLLSYRLFPTGWLDLIFMLISYLWLDSSLPSLTNLVQALLPASVILLINILRPRST
SSTGPEKPRLIPCRTTHARLFPREHAFAYSYLVVGVPVGFSGSAGGIVSAGLEGRPWLERAWYDVDAVDYLRRGA
GELGLRGKLDDFLRDEHVDPNDYPHAYLVTAARFLGYHFNPVSFWFLYTADKHLSAMILEVNNTFGERRAYLVFR
DEQHDKIKASWPKDFHVSPFNSRRGSYTVTANDPLGPGMDGFRGLDISIRLRSSKGRAKLVARLFSEGDAIDASL
MSARQRFGFLVAWCWVGFVTFPRIAREAAALYIRRGLHVWYRPEPLRGSLARVADGGERCLERAFRGYLQSLAED
KGVPVTYIPSGLVDGPASYTWAANEAVEHVEIRVLTPVFYSRFVGYVDSLEAMLVEMTESGTVWIDKPQALTVIF
PLAADEPLPWMGWKDVVIFKLIRSLRRRPASIPQPPPPSSIPSRPPKPPIQKHLFSPLDAFTLRFPANSALRADY
CKSVLRLFLAECLLGSRTELVDAVLVLSRAGLAFLTAWLVRGFEERFGRGMMVP*
Coding >Ophcf2|05476
ATGCGGTGGTCGCTTCTTAGGGCGCCGCTCCTGGCCGTCGCCTCCATGGCGTCGCTGGCGACCGGCGAGAAGCTG
CTCATGTCGAGTTCCCTCAACACGTGTCAGCAAGACTCGAGCTTCTCGGCCTCGCTCTTCAACGTCGTCTACACA
CCGAATAACAACTCGGCTAGCATCAACATTGTTGCCACGTCTTCCGTCCAAGGCAAGGTGATTTTCGACCTCGCC
ATCTCGGCCTACGGCTACCAGTTCCTTCGCATGACGCTCAACCCCTGCGACATGGACTTGGCAGGCCTTTGCCCC
ATGGTGGCCGGCAAGATCCCCTTTGGCTTCAACCTACCGGTCGGCAAGGACGCCGCCCAGCGGATCCCCAATATC
GCCTACAATATCCCCGACCTCGACGCCACCGTCCGCGTCTACGTCAACCTGACGGCCACGGGCGAGAGCGTAGCC
TGCGTCGAGGCCGACATCTCCAACGGCAAGACGGTCGACCTCATCGGCGTCAAGTGGGCGACGGCCATCATCGCC
GGCCTCGCCCTCATCGCCTCGGCCGTCGTCAATGGTCTCGGCCACTCCAACACGGCCGCTCACGTTGCCGCCAAT
TCGCTCTCCCTCTTCGGCTACTTCCAGGCCCAGGCCATCGTCGGCCTGACGAGCGTGCCGCTGCCACCCATTGTT
CAGTCGTGGACCCAGGACTTCCAGTGGTCCATGGGCATCATCCGCGTCGGCTTCATGCAGGACATCTTCACCTGG
TACCAGCGCGCCACGGGCGGCACGCCCTCGACCATCTTCGATTCCCTCACCACCGTCTCCGTTCAGGTGGCCAAG
CGGTCGCTCGAGTACGCCGACGCCAGCCTCAGCCTCTTCAAGCGCGGCGCCGCCATGATGCCGCGCGCCGTCACC
GCCGCCGCCCATGGCCTGGTGCGCCGAAACAACATCACGACGGGCTCGGGCGCCTACATCGTCTTCGGCATCCAG
CGCGTCGCCTTCCGGTCCAAGATCGAGACGACCAACCTCTTCATGACGGGTCTCACTTTTTTCTGCATCTTCGTC
GTCCTCACCGTCCTCTCCGTCGCCGCCTTCAAGGGCATCTGCGAGCTCAGCGTCAAGAACAAGTGGATGGACAAG
GATAAGTTCCTCGACTTCCGCAACGGCTGGCTCACCGTCCTCAAGGGCATCCTCTTCCGCGTCGCCCTCATCGGC
TTCCCCCAGATGGCCATCCTCTGCCTCTGGGAGTTCACCCAGGTCGACTCGCCCGCAGAGGTCGTCCTCGCCGTC
TTCTTCTTCTTCGGCATGGCCCTGACGCTGGCCTGGGGCGCGGCCAAGGTGATCCGCATCGCCCGCCGGTCCGTC
GCCATGCACCGAAACCCGGCCTACATCCTCTTCTCCGACCCCCAGGCCCTCAACAAGTGGGGGTTCCTCTACATC
CAGTTCCGCGCCTCGGCCTACTACTTCATCGCCCCGGTCCTGGGCTACACGCTCATCAAGGCCATGTTCGTCGCC
TTCTCGCAGCGCAACGCCGTCGCCCAGGCCGTCGGCTTCGTCATCATCGAGGCTGCCGCGCTGATCGCCGCCTCG
GTGCTACGCCCGTGGATGGACAAGAGCACCAACTCGTTCAACATCGCCATCTGCGTCGTCAACTTCCTCAACGCC
ATCTTCCTCCTCATCTTCTCCAACGTCTTTGGCGCCCCCAGCCTCGTCGTCGGCGTCGTCGGCGTCGTGCTCTTC
GTCCTCAACGCCGCCTTTTCCCTCATCCTGCTCATCATGGTCATCGTCTCCACCACCGTCACCTTCTTCCGCAAG
AACCCGGACGCCCGCTACCAGGTCATGGCCGACGATCGGGCTTCGTTTATGAAGTCGCAGACGCAGCTGACGACG
ACGACGGAGCTCGACGCCCTCGCCGCCACGGCCCGCGGCGACAAGGCCGGCTACAAGGTGCACCTCGACCTCGAC
GACGACAACGAGTCCCTGGCGTCGGAGGACCTGCGCCGCCGCGGAGTGCCGGATCCCAACGGCTCCCACTCGTCG
CAGGCCTCGTTCCACAACGCACAGCAGCAGCACCACGCGTCGCCGCCGCCGGTGAACCCGTCGATGCCGCTGTTC
CCTGCCGGCGGGCCGCGCTCCCAGAGCCCGTTCCGGTCGCCGTCGCCCAGCAGCTACACGCGGTCGGGGTCGTCG
CTGGGGCAGCAGCGGCCGCAGGGGGCGACGAGCCCGGCCGGATATCGCGCGCAAAACTCGCCGAGTCCATGGCAA
CGAGGCGCCGGCTACGACAAGGCGGTCGATGGCCTGCTCTACGCTCTGCTCCTCCTGCTGCTGCTGTCCTACCGG
CTGTTTCCCACCGGCTGGCTGGACCTCATCTTCATGCTGATATCCTACCTCTGGCTCGACTCCTCCCTCCCCTCG
CTCACCAACCTCGTGCAAGCTCTCCTCCCAGCAAGCGTCATCCTACTGATCAACATCCTCCGCCCGCGATCCACG
TCCAGCACCGGTCCGGAGAAACCGCGCCTCATCCCCTGCCGCACGACGCACGCACGCCTCTTTCCACGGGAGCAC
GCCTTTGCATACTCGTATCTCGTCGTCGGTGTGCCGGTCGGCTTCTCAGGTAGCGCTGGGGGTATCGTCTCGGCG
GGGCTGGAGGGAAGGCCGTGGTTGGAAAGGGCTTGGTATGATGTCGACGCCGTGGATTATCTGCGTAGAGGCGCC
GGTGAGCTCGGTCTAAGGGGGAAGCTGGATGACTTTCTCCGCGACGAGCATGTTGATCCCAACGACTATCCGCAC
GCCTACCTCGTCACAGCCGCCCGCTTCTTAGGCTACCACTTCAACCCGGTCTCCTTCTGGTTCCTCTACACAGCA
GACAAGCACCTCTCAGCCATGATCCTCGAAGTGAACAACACCTTTGGCGAAAGACGAGCCTACCTCGTCTTCCGA
GACGAGCAGCACGACAAGATCAAAGCATCATGGCCCAAAGACTTCCACGTCTCGCCCTTCAATTCCCGCCGCGGA
AGCTATACCGTCACGGCGAACGACCCCCTCGGTCCCGGGATGGACGGCTTCCGCGGTCTAGACATCTCTATCCGT
CTGCGCTCTTCCAAGGGGCGGGCAAAGCTTGTTGCTCGTCTCTTTTCCGAGGGAGACGCCATCGACGCGTCGCTG
ATGAGCGCGAGGCAGCGTTTTGGATTCCTCGTTGCTTGGTGTTGGGTGGGCTTTGTGACGTTTCCTCGGATTGCT
AGAGAGGCGGCTGCTTTGTACATTCGGCGTGGGCTTCATGTTTGGTATCGGCCCGAGCCGTTGAGGGGGAGTCTG
GCGAGGGTCGCGGATGGGGGAGAGCGATGCTTGGAGCGCGCGTTTCGAGGATACCTACAGTCTCTGGCCGAGGAC
AAGGGCGTTCCCGTCACATATATCCCCAGCGGCCTCGTCGATGGGCCTGCTTCTTACACCTGGGCAGCAAACGAG
GCAGTCGAGCACGTCGAGATCCGGGTCCTTACACCCGTCTTTTACTCCCGCTTCGTCGGCTACGTCGACAGCCTG
GAAGCCATGCTGGTGGAGATGACGGAGAGCGGGACGGTGTGGATCGACAAGCCACAAGCTCTGACAGTTATATTT
CCCCTCGCAGCAGACGAACCTTTACCATGGATGGGCTGGAAAGACGTCGTCATCTTCAAACTCATCCGGTCTCTC
CGCCGTCGACCCGCATCCATTCCCCAGCCACCACCGCCAAGCTCAATACCGAGTCGTCCCCCGAAGCCCCCAATC
CAGAAGCACCTCTTCTCTCCTCTGGACGCCTTCACCCTCAGATTCCCAGCCAACTCGGCCCTCAGAGCGGACTAT
TGCAAGTCTGTCCTCCGCCTCTTCCTCGCCGAGTGTCTCCTCGGAAGCCGGACGGAACTCGTCGACGCGGTCCTT
GTGCTTTCACGCGCGGGCCTCGCTTTCCTGACGGCCTGGCTGGTACGAGGGTTCGAGGAGCGGTTTGGCCGCGGC
ATGATGGTGCCCTGA
Transcript >Ophcf2|05476
ATGCGGTGGTCGCTTCTTAGGGCGCCGCTCCTGGCCGTCGCCTCCATGGCGTCGCTGGCGACCGGCGAGAAGCTG
CTCATGTCGAGTTCCCTCAACACGTGTCAGCAAGACTCGAGCTTCTCGGCCTCGCTCTTCAACGTCGTCTACACA
CCGAATAACAACTCGGCTAGCATCAACATTGTTGCCACGTCTTCCGTCCAAGGCAAGGTGATTTTCGACCTCGCC
ATCTCGGCCTACGGCTACCAGTTCCTTCGCATGACGCTCAACCCCTGCGACATGGACTTGGCAGGCCTTTGCCCC
ATGGTGGCCGGCAAGATCCCCTTTGGCTTCAACCTACCGGTCGGCAAGGACGCCGCCCAGCGGATCCCCAATATC
GCCTACAATATCCCCGACCTCGACGCCACCGTCCGCGTCTACGTCAACCTGACGGCCACGGGCGAGAGCGTAGCC
TGCGTCGAGGCCGACATCTCCAACGGCAAGACGGTCGACCTCATCGGCGTCAAGTGGGCGACGGCCATCATCGCC
GGCCTCGCCCTCATCGCCTCGGCCGTCGTCAATGGTCTCGGCCACTCCAACACGGCCGCTCACGTTGCCGCCAAT
TCGCTCTCCCTCTTCGGCTACTTCCAGGCCCAGGCCATCGTCGGCCTGACGAGCGTGCCGCTGCCACCCATTGTT
CAGTCGTGGACCCAGGACTTCCAGTGGTCCATGGGCATCATCCGCGTCGGCTTCATGCAGGACATCTTCACCTGG
TACCAGCGCGCCACGGGCGGCACGCCCTCGACCATCTTCGATTCCCTCACCACCGTCTCCGTTCAGGTGGCCAAG
CGGTCGCTCGAGTACGCCGACGCCAGCCTCAGCCTCTTCAAGCGCGGCGCCGCCATGATGCCGCGCGCCGTCACC
GCCGCCGCCCATGGCCTGGTGCGCCGAAACAACATCACGACGGGCTCGGGCGCCTACATCGTCTTCGGCATCCAG
CGCGTCGCCTTCCGGTCCAAGATCGAGACGACCAACCTCTTCATGACGGGTCTCACTTTTTTCTGCATCTTCGTC
GTCCTCACCGTCCTCTCCGTCGCCGCCTTCAAGGGCATCTGCGAGCTCAGCGTCAAGAACAAGTGGATGGACAAG
GATAAGTTCCTCGACTTCCGCAACGGCTGGCTCACCGTCCTCAAGGGCATCCTCTTCCGCGTCGCCCTCATCGGC
TTCCCCCAGATGGCCATCCTCTGCCTCTGGGAGTTCACCCAGGTCGACTCGCCCGCAGAGGTCGTCCTCGCCGTC
TTCTTCTTCTTCGGCATGGCCCTGACGCTGGCCTGGGGCGCGGCCAAGGTGATCCGCATCGCCCGCCGGTCCGTC
GCCATGCACCGAAACCCGGCCTACATCCTCTTCTCCGACCCCCAGGCCCTCAACAAGTGGGGGTTCCTCTACATC
CAGTTCCGCGCCTCGGCCTACTACTTCATCGCCCCGGTCCTGGGCTACACGCTCATCAAGGCCATGTTCGTCGCC
TTCTCGCAGCGCAACGCCGTCGCCCAGGCCGTCGGCTTCGTCATCATCGAGGCTGCCGCGCTGATCGCCGCCTCG
GTGCTACGCCCGTGGATGGACAAGAGCACCAACTCGTTCAACATCGCCATCTGCGTCGTCAACTTCCTCAACGCC
ATCTTCCTCCTCATCTTCTCCAACGTCTTTGGCGCCCCCAGCCTCGTCGTCGGCGTCGTCGGCGTCGTGCTCTTC
GTCCTCAACGCCGCCTTTTCCCTCATCCTGCTCATCATGGTCATCGTCTCCACCACCGTCACCTTCTTCCGCAAG
AACCCGGACGCCCGCTACCAGGTCATGGCCGACGATCGGGCTTCGTTTATGAAGTCGCAGACGCAGCTGACGACG
ACGACGGAGCTCGACGCCCTCGCCGCCACGGCCCGCGGCGACAAGGCCGGCTACAAGGTGCACCTCGACCTCGAC
GACGACAACGAGTCCCTGGCGTCGGAGGACCTGCGCCGCCGCGGAGTGCCGGATCCCAACGGCTCCCACTCGTCG
CAGGCCTCGTTCCACAACGCACAGCAGCAGCACCACGCGTCGCCGCCGCCGGTGAACCCGTCGATGCCGCTGTTC
CCTGCCGGCGGGCCGCGCTCCCAGAGCCCGTTCCGGTCGCCGTCGCCCAGCAGCTACACGCGGTCGGGGTCGTCG
CTGGGGCAGCAGCGGCCGCAGGGGGCGACGAGCCCGGCCGGATATCGCGCGCAAAACTCGCCGAGTCCATGGCAA
CGAGGCGCCGGCTACGACAAGGCGGTCGATGGCCTGCTCTACGCTCTGCTCCTCCTGCTGCTGCTGTCCTACCGG
CTGTTTCCCACCGGCTGGCTGGACCTCATCTTCATGCTGATATCCTACCTCTGGCTCGACTCCTCCCTCCCCTCG
CTCACCAACCTCGTGCAAGCTCTCCTCCCAGCAAGCGTCATCCTACTGATCAACATCCTCCGCCCGCGATCCACG
TCCAGCACCGGTCCGGAGAAACCGCGCCTCATCCCCTGCCGCACGACGCACGCACGCCTCTTTCCACGGGAGCAC
GCCTTTGCATACTCGTATCTCGTCGTCGGTGTGCCGGTCGGCTTCTCAGGTAGCGCTGGGGGTATCGTCTCGGCG
GGGCTGGAGGGAAGGCCGTGGTTGGAAAGGGCTTGGTATGATGTCGACGCCGTGGATTATCTGCGTAGAGGCGCC
GGTGAGCTCGGTCTAAGGGGGAAGCTGGATGACTTTCTCCGCGACGAGCATGTTGATCCCAACGACTATCCGCAC
GCCTACCTCGTCACAGCCGCCCGCTTCTTAGGCTACCACTTCAACCCGGTCTCCTTCTGGTTCCTCTACACAGCA
GACAAGCACCTCTCAGCCATGATCCTCGAAGTGAACAACACCTTTGGCGAAAGACGAGCCTACCTCGTCTTCCGA
GACGAGCAGCACGACAAGATCAAAGCATCATGGCCCAAAGACTTCCACGTCTCGCCCTTCAATTCCCGCCGCGGA
AGCTATACCGTCACGGCGAACGACCCCCTCGGTCCCGGGATGGACGGCTTCCGCGGTCTAGACATCTCTATCCGT
CTGCGCTCTTCCAAGGGGCGGGCAAAGCTTGTTGCTCGTCTCTTTTCCGAGGGAGACGCCATCGACGCGTCGCTG
ATGAGCGCGAGGCAGCGTTTTGGATTCCTCGTTGCTTGGTGTTGGGTGGGCTTTGTGACGTTTCCTCGGATTGCT
AGAGAGGCGGCTGCTTTGTACATTCGGCGTGGGCTTCATGTTTGGTATCGGCCCGAGCCGTTGAGGGGGAGTCTG
GCGAGGGTCGCGGATGGGGGAGAGCGATGCTTGGAGCGCGCGTTTCGAGGATACCTACAGTCTCTGGCCGAGGAC
AAGGGCGTTCCCGTCACATATATCCCCAGCGGCCTCGTCGATGGGCCTGCTTCTTACACCTGGGCAGCAAACGAG
GCAGTCGAGCACGTCGAGATCCGGGTCCTTACACCCGTCTTTTACTCCCGCTTCGTCGGCTACGTCGACAGCCTG
GAAGCCATGCTGGTGGAGATGACGGAGAGCGGGACGGTGTGGATCGACAAGCCACAAGCTCTGACAGTTATATTT
CCCCTCGCAGCAGACGAACCTTTACCATGGATGGGCTGGAAAGACGTCGTCATCTTCAAACTCATCCGGTCTCTC
CGCCGTCGACCCGCATCCATTCCCCAGCCACCACCGCCAAGCTCAATACCGAGTCGTCCCCCGAAGCCCCCAATC
CAGAAGCACCTCTTCTCTCCTCTGGACGCCTTCACCCTCAGATTCCCAGCCAACTCGGCCCTCAGAGCGGACTAT
TGCAAGTCTGTCCTCCGCCTCTTCCTCGCCGAGTGTCTCCTCGGAAGCCGGACGGAACTCGTCGACGCGGTCCTT
GTGCTTTCACGCGCGGGCCTCGCTTTCCTGACGGCCTGGCTGGTACGAGGGTTCGAGGAGCGGTTTGGCCGCGGC
ATGATGGTGCCCTGA
Gene >Ophcf2|05476
ATGCGGTGGTCGCTTCTTAGGGCGCCGCTCCTGGCCGTCGCCTCCATGGCGTCGCTGGCGACCGGCGAGAAGCTG
CTCATGTCGAGTTCCCTCAACACGTGTCAGCAAGACTCGAGCTTCTCGGCCTCGCTCTTCAACGTCGTCTACACA
CCGAATAACAACTCGGCTAGCATCAACATTGTTGCCACGTCTTCCGTCCAAGGCAAGGTGATTTTCGACCTCGCC
ATCTCGGCCTACGGCTACCAGTTCCTTCGCATGACGCTCAACCCCTGCGACATGGACTTGGCAGGCCTTTGCCCC
ATGGTGGCCGGCAAGATCCCCTTTGGCTTCAACCTACCGGTCGGCAAGGACGCCGCCCAGCGGATCCCCAATATC
GCCTACAATATCCCCGACCTCGACGCCACCGTCCGCGTCTACGTCAACCTGACGGCCACGGGCGAGAGCGTAGCC
TGCGTCGAGGCCGACATCTCCAACGGCAAGACGGTCGACCTCATCGGCGTCAAGTGGGCGACGGCCATCATCGCC
GGCCTCGCCCTCATCGCCTCGGCCGTCGTCAATGGTCTCGGCCACTCCAACACGGCCGCTCACGTTGCCGCCAAT
TCGCTCTCCCTCTTCGGCTACTTCCAGGCCCAGGCCATCGTCGGCCTGACGAGCGTGCCGCTGCCACCCATTGTT
CAGTCGTGGACCCAGGACTTCCAGTGGTCCATGGGCATCATCCGCGTCGGCTTCATGCAGGACATCTTCACCTGG
TACCAGCGCGCCACGGGCGGCACGCCCTCGACCATCTTCGATTCCCTCACCACCGTCTCCGTTCAGGTGGCCAAG
CGGTCGCTCGAGTACGCCGACGCCAGCCTCAGCCTCTTCAAGCGCGGCGCCGCCATGATGCCGCGCGCCGTCACC
GCCGCCGCCCATGGCCTGGTGCGCCGAAACAACATCACGACGGGCTCGGGCGCCTACATCGTCTTCGGCATCCAG
CGCGTCGCCTTCCGGTCCAAGATCGAGACGACCAACCTCTTCATGACGGGTCTCACTTTTTTCTGCATCTTCGTC
GTCCTCACCGTCCTCTCCGTCGCCGCCTTCAAGGGCATCTGCGAGCTCAGCGTCAAGAACAAGTGGATGGACAAG
GATAAGTTCCTCGACTTCCGCAACGGCTGGCTCACCGTCCTCAAGGGCATCCTCTTCCGCGTCGCCCTCATCGGC
TTCCCCCAGATGGCCATCCTCTGCCTCTGGGAGTTCACCCAGGTCGACTCGCCCGCAGAGGTCGTCCTCGCCGTC
TTCTTCTTCTTCGGCATGGCCCTGACGCTGGCCTGGGGCGCGGCCAAGGTGATCCGCATCGCCCGCCGGTCCGTC
GCCATGCACCGAAACCCGGCCTACATCCTCTTCTCCGACCCCCAGGCCCTCAACAAGTGGGGGTTCCTCTACATC
CAGTTCCGCGCCTCGGCCTACTACTTCATCGCCCCGGTCCTGGGCTACACGCTCATCAAGGCCATGTTCGTCGCC
TTCTCGCAGCGCAACGCCGTCGCCCAGGCCGTCGGCTTCGTCATCATCGAGGCTGCCGCGCTGATCGCCGCCTCG
GTGCTACGCCCGTGGATGGACAAGAGCACCAACTCGTTCAACATCGCCATCTGCGTCGTCAACTTCCTCAACGCC
ATCTTCCTCCTCATCTTCTCCAACGTCTTTGGCGCCCCCAGCCTCGTCGTCGGCGTCGTCGGCGTCGTGCTCTTC
GTCCTCAACGCCGCCTTTTCCCTCATCCTGCTCATCATGGTCATCGTCTCCACCACCGTCACCTTCTTCCGCAAG
AACCCGGACGCCCGCTACCAGGTCATGGCCGACGATCGGGCTTCGTTTATGAAGTCGCAGACGCAGCTGACGACG
ACGACGGAGCTCGACGCCCTCGCCGCCACGGCCCGCGGCGACAAGGCCGGCTACAAGGTGCACCTCGACCTCGAC
GACGACAACGAGTCCCTGGCGTCGGAGGACCTGCGCCGCCGCGGAGTGCCGGATCCCAACGGCTCCCACTCGTCG
CAGGCCTCGTTCCACAACGCACAGCAGCAGCACCACGCGTCGCCGCCGCCGGTGAACCCGTCGATGCCGCTGTTC
CCTGCCGGCGGGCCGCGCTCCCAGAGCCCGTTCCGGTCGCCGTCGCCCAGCAGCTACACGCGGTCGGGGTCGTCG
CTGGGGCAGCAGCGGCCGCAGGGGGCGACGAGCCCGGCCGGATATCGCGCGCAAAACTCGCCGAGGTGGGTTGTC
GGACATGGTATCGAGGAGTCATGATGGCGCGGCTAACGAGATGAACAGTCCATGGCAACGAGGCGCCGGCTACGA
GTAGGACTAGGGGTTCGGCGAAAAGGTGTTGTGTGGTTAAGGAGCTTCGACGTCGACGGCATACCTATACGAGAC
CTTGCCCTCGCCGTCGGACATGTACACGGAACAACAATGGTAAGACGGGGAAACTGGAGCCACATCGACATGGTT
CGACTGCCGTGTCTTGGACGGCCGGGGACTGTCTGTTCATGGCGATGAAGCTGGTCCACGGCGCTTGGTCCCTCG
CAGCCACCCGTTTCCCCCCCTCCCCCCCCCCCTGTCTCGCGTTATATCTTCTTTTTTTATTCTTTGACGCCAAGG
CATGACGGCTGTCTGCCTGGCCTGGTGCTACGGACAAGGATCGATGGTCTGGAACTGGGATATTCTTAAGCTGTC
CCCCTTTGCGACGATGGATCTGCTTGTATATATCCGGGGGGCGGAATTTCTGCCGTGGATGAGGATGGGGAATAT
TTCATCATGTCGAGTATGAATAATCAGCTGGTCGTAGACTTGCTGGGTGGGATGAGAGCCGGGGTGGATGAAGCA
TTGTTGAGTAGATGCCAGATCTGACAGTATTATCATGTCTTCGCGAAGGGTTCTGAGGGTGACTCAGTTTGAACA
GGGTGACGGATGGGGGCCAGCCCTTAGACCGTCGCTATTGCTAAAAAAGACTAGCCTTGTTTTCATTTGCTGGAT
ATCGTCAGATTCTATAGCAGAAGTTCTGTATTCGTAGAACGTACGAAGTATGTACGAATATGTACGACTTGATAT
TCCAAGGGATTCGTGTTCGTATTCATATCAAGCTATCAGCACATGACCTCGACGACCTCTCTTCATCACTATTCA
CCTTACACCTCCTCATCTACCATGTGAATACCGCGCAACCAACCGAGTATTGAAGCAACACCTTGATGGTCTCGT
CATGGATCTTTGATATAGCCGTTTCCTCCCGCTCGTTTCTCTCCTCGCCGGCGGGTCATGGACAGTTTCTCGCTC
AGCAAGGCGGTCGATGGCCTGCTCTACGCTCTGCTCCTCCTGCTGCTGCTGTCCTACCGGCTGTTTCCCACCGGC
TGGCTGGACCTCATCTTCATGCTGATATCCTACCTCTGGCTCGACTCCTCCCTCCCCTCGCTCACCAACCTCGTG
CAAGCTCTCCTCCCAGCAAGCGTCATCCTACTGATCAACATCCTCCGCCCGCGATCCACGTCCAGCACCGGTCCG
GAGAAACCGCGCCTCATCCCCTGCCGCACGACGCACGCACGCCTCTTTCCACGGGAGCACGCCTTTGCATACTCG
TATCTCGTCGTCGGTGTGCCGGTCGGCTTCTCAGGTAGCGCTGGGGGTATCGTCTCGGCGGGGCTGGAGGGAAGG
CCGTGGTTGGAAAGGGCTTGGTATGATGTCGACGCCGTGGATTATCTGCGTAGAGGCGCCGGTGAGCTCGGTCTA
AGGGGGAAGCTGGATGACTTTCTCCGCGACGAGGTCCGTTTTTTTTTTCAACCTGAGCTTTGCTGAGACTTTGCT
GATTTTTGACGGCAGCATGTTGATCCCAACGACTATCCGCACGCCTACCTCGTCACAGCCGCCCGCTTCTTAGGC
TACCACTTCAACCCGGTCTCCTTCTGGTTCCTCTACACAGCAGACAAGCACCTCTCAGCCATGATCCTCGAAGTG
AACAACACCTTTGGCGAAAGACGAGCCTACCTCGTCTTCCGAGACGAGCAGCACGACAAGATCAAAGCATCATGG
CCCAAAGACTTCCACGTCTCGCCCTTCAATTCCCGCCGCGGAAGCTATACCGTCACGGCGAACGACCCCCTCGGT
CCCGGGATGGACGGCTTCCGCGGTCTAGACATCTCTATCCGTCTGCGCTCTTCCAAGGGGCGGGCAAAGCTTGTT
GCTCGTCTCTTTTCCGAGGGAGACGCCATCGACGCGTCGCTGATGAGCGCGAGGCAGCGTTTTGGATTCCTCGTT
GCTTGGTGTTGGGTGGGCTTTGTGACGTTTCCTCGGATTGCTAGAGAGGCGGCTGCTTTGTACATTCGGCGTGGG
CTTCATGTTTGGTATCGGCCCGAGCCGTTGAGGGGGAGTCTGGCGAGGGTCGCGGATGGGGGAGAGCGATGCTTG
GAGCGCGCGTTTCGAGGATACCTACAGTCTCTGGCCGAGGACAAGGGCGTTCCCGTCACATATATCCCCAGCGGC
CTCGTCGATGGGCCTGCTTCTTACACCTGGGCAGCAAACGAGGCAGTCGAGCACGTCGAGATCCGGGTCCTTACA
CCCGTCTTTTACTCCCGCTTCGTCGGCTACGTCGACAGCCTGGAAGCCATGCTGGTGGAGATGACGGAGAGCGGG
ACGGTGTGGATCGACAAGCCACAAGCTCTGACAGTTATATTTCCCCTCGCAGCAGACGAACCTTTACCATGGATG
GGCTGGAAAGACGTCGTCATCTTCAAACTCATCCGGTCTCTCCGCCGTCGACCCGCATCCATTCCCCAGCCACCA
CCGCCAAGCTCAATACCGAGTCGTCCCCCGAAGCCCCCAATCCAGAAGCACCTCTTCTCTCCTCTGGACGCCTTC
ACCCTCAGATTCCCAGCCAACTCGGCCCTCAGAGCGGACTATTGCAAGTCTGTCCTCCGCCTCTTCCTCGCCGAG
TGTCTCCTCGGAAGCCGGACGGAACTCGTCGACGCGGTCCTTGTGCTTTCACGCGCGGGCCTCGCTTTCCTGACG
GCCTGGCTGGTACGAGGGTTCGAGGAGCGGTTTGGCCGCGGCATGATGGTGCCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail