Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05456
Gene name
Locationscaffold_06:207239..208001
Strand+
Gene length (bp)762
Transcript length (bp)762
Coding sequence length (bp)762
Protein length (aa) 254

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04115 Ureidogly_lyase Ureidoglycolate lyase 1.5E-51 44 236

GO

GO Term Description Terminal node
GO:0000256 allantoin catabolic process Yes
GO:0050385 ureidoglycolate lyase activity Yes
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:0009056 catabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:0043605 cellular amide catabolic process No
GO:0003824 catalytic activity No
GO:1901360 organic cyclic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0016840 carbon-nitrogen lyase activity No
GO:0071704 organic substance metabolic process No
GO:0046700 heterocycle catabolic process No
GO:0044248 cellular catabolic process No
GO:0016842 amidine-lyase activity No
GO:1901361 organic cyclic compound catabolic process No
GO:0000255 allantoin metabolic process No
GO:0043603 cellular amide metabolic process No
GO:1901575 organic substance catabolic process No
GO:0008150 biological_process No
GO:0044270 cellular nitrogen compound catabolic process No
GO:0016829 lyase activity No
GO:0034641 cellular nitrogen compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Peroxisomal targeting signal 0.4828 0.6738 0.0562 0.0231 0.0454 0.1363 0.0443 0.045 0.0134 0.5913

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6264
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3435
Ophiocordyceps australis map64 (Brazil) OphauB2|7127
Ophiocordyceps camponoti-floridani Ophcf2|05456 (this protein)
Ophiocordyceps kimflemingae Ophio5|6924
Ophiocordyceps subramaniannii Hirsu2|7948

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05456
MSRPNVDIKHHVPLPPYNNEEPTTTSSKQMASRLKMQVRASERQTITAEALRPSTFAPFGSVIENPCPSIHPSST
AAASLPSNASPANDGTAIQYRNVSPMTNLHQGSAAKPRMSIFACATHDADAGPLAIPALERHPFTTQTFIPISSP
ASAYLVVVCPCRAPEDDDVRLPRWRGMPDLRGLRAFVASASQAVTYEAGTWHAPMMALGSEGQRLDFVVVQFASG
VADEDCQLVRLVPCEDQPRVVVGQGARL*
Coding >Ophcf2|05456
ATGTCACGCCCGAATGTCGACATCAAACATCACGTGCCGCTCCCACCTTACAACAATGAGGAGCCAACGACAACC
TCGTCCAAACAAATGGCGTCAAGGCTGAAGATGCAGGTCCGCGCCTCAGAACGTCAGACCATAACCGCCGAAGCA
CTCAGACCCAGCACCTTTGCTCCCTTTGGCAGCGTCATCGAAAATCCTTGTCCAAGCATCCACCCCTCGAGCACG
GCAGCAGCCTCACTCCCCAGCAACGCCTCCCCCGCAAACGACGGAACCGCAATCCAATATCGTAATGTCAGCCCC
ATGACGAACCTCCACCAAGGAAGCGCCGCAAAGCCACGAATGAGCATCTTCGCCTGCGCAACCCACGACGCGGAC
GCAGGCCCCCTCGCCATCCCCGCTCTAGAACGCCACCCGTTCACGACGCAGACCTTCATCCCCATCTCGTCACCC
GCGAGCGCATACCTCGTCGTCGTGTGTCCCTGCCGGGCCCCCGAAGATGATGACGTGCGGCTGCCGAGGTGGAGG
GGAATGCCGGACCTGCGTGGGCTGCGGGCCTTTGTGGCTTCGGCTTCGCAGGCGGTCACGTACGAGGCGGGGACG
TGGCATGCGCCTATGATGGCTCTTGGGAGCGAGGGCCAGCGGCTGGACTTTGTGGTGGTGCAGTTTGCGAGCGGC
GTGGCGGATGAGGATTGTCAACTTGTGAGGCTGGTGCCTTGTGAGGACCAGCCGCGGGTTGTTGTCGGTCAGGGG
GCGAGGCTGTGA
Transcript >Ophcf2|05456
ATGTCACGCCCGAATGTCGACATCAAACATCACGTGCCGCTCCCACCTTACAACAATGAGGAGCCAACGACAACC
TCGTCCAAACAAATGGCGTCAAGGCTGAAGATGCAGGTCCGCGCCTCAGAACGTCAGACCATAACCGCCGAAGCA
CTCAGACCCAGCACCTTTGCTCCCTTTGGCAGCGTCATCGAAAATCCTTGTCCAAGCATCCACCCCTCGAGCACG
GCAGCAGCCTCACTCCCCAGCAACGCCTCCCCCGCAAACGACGGAACCGCAATCCAATATCGTAATGTCAGCCCC
ATGACGAACCTCCACCAAGGAAGCGCCGCAAAGCCACGAATGAGCATCTTCGCCTGCGCAACCCACGACGCGGAC
GCAGGCCCCCTCGCCATCCCCGCTCTAGAACGCCACCCGTTCACGACGCAGACCTTCATCCCCATCTCGTCACCC
GCGAGCGCATACCTCGTCGTCGTGTGTCCCTGCCGGGCCCCCGAAGATGATGACGTGCGGCTGCCGAGGTGGAGG
GGAATGCCGGACCTGCGTGGGCTGCGGGCCTTTGTGGCTTCGGCTTCGCAGGCGGTCACGTACGAGGCGGGGACG
TGGCATGCGCCTATGATGGCTCTTGGGAGCGAGGGCCAGCGGCTGGACTTTGTGGTGGTGCAGTTTGCGAGCGGC
GTGGCGGATGAGGATTGTCAACTTGTGAGGCTGGTGCCTTGTGAGGACCAGCCGCGGGTTGTTGTCGGTCAGGGG
GCGAGGCTGTGA
Gene >Ophcf2|05456
ATGTCACGCCCGAATGTCGACATCAAACATCACGTGCCGCTCCCACCTTACAACAATGAGGAGCCAACGACAACC
TCGTCCAAACAAATGGCGTCAAGGCTGAAGATGCAGGTCCGCGCCTCAGAACGTCAGACCATAACCGCCGAAGCA
CTCAGACCCAGCACCTTTGCTCCCTTTGGCAGCGTCATCGAAAATCCTTGTCCAAGCATCCACCCCTCGAGCACG
GCAGCAGCCTCACTCCCCAGCAACGCCTCCCCCGCAAACGACGGAACCGCAATCCAATATCGTAATGTCAGCCCC
ATGACGAACCTCCACCAAGGAAGCGCCGCAAAGCCACGAATGAGCATCTTCGCCTGCGCAACCCACGACGCGGAC
GCAGGCCCCCTCGCCATCCCCGCTCTAGAACGCCACCCGTTCACGACGCAGACCTTCATCCCCATCTCGTCACCC
GCGAGCGCATACCTCGTCGTCGTGTGTCCCTGCCGGGCCCCCGAAGATGATGACGTGCGGCTGCCGAGGTGGAGG
GGAATGCCGGACCTGCGTGGGCTGCGGGCCTTTGTGGCTTCGGCTTCGCAGGCGGTCACGTACGAGGCGGGGACG
TGGCATGCGCCTATGATGGCTCTTGGGAGCGAGGGCCAGCGGCTGGACTTTGTGGTGGTGCAGTTTGCGAGCGGC
GTGGCGGATGAGGATTGTCAACTTGTGAGGCTGGTGCCTTGTGAGGACCAGCCGCGGGTTGTTGTCGGTCAGGGG
GCGAGGCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail