Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05454
Gene name
Locationscaffold_06:203341..204881
Strand+
Gene length (bp)1540
Transcript length (bp)1359
Coding sequence length (bp)1359
Protein length (aa) 453

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16010 CDH-cyt Cytochrome domain of cellobiose dehydrogenase 2.5E-23 20 181
PF03188 Cytochrom_B561 Eukaryotic cytochrome b561 4.6E-09 236 337

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 215 237 22
2 244 266 22
3 281 300 19
4 320 337 17
5 347 366 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 39.23 21.31 57.14
Alive In ants, during behavior modification 5.48 1.54 9.42
Dead In ants, recently dead 9.90 3.85 15.96

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.016314 yes
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05454
MRLALTAALAAAAASALQSTFVSPNRDLAFALSVPDTDNTDIFFSIRAPISYAWAAVGLGSDDMKGALFLIIYRN
KHRDNVTLSPRLAYGNYEPQHYPDMQYDVLPGSGIDGDHMVLNARCTQHCRSWPAADSNSGYMDVSSASGKAIFA
MGPRAGFGSDSPAADLQFHREFGVFSIDIKRTLGAPDPPKLEDDSESVGTSLDYRRTGRREPRSSLHGSFMVFSV
VFLLPVGAALRSSERWARFHSLCQSMAVLIMLAGVVTGVLASFRYQRSRNFRAHHQIIGFIVVGFVLAQLVLGFL
HQRKMRKTNMPTNQGRYHRYLGGAIIIFGVLNAFFGFDLALDYKLGYTLCGFVLISVFVVLFLYLSRRGVRGRRQ
RQTATTADGPSTGYQPQPWREEPNPPDAPPSYDAASSQYISLQPVPSRASPWRGSDVKDGGDDQPALGGLQRPRE
FT*
Coding >Ophcf2|05454
ATGAGGCTCGCGCTCACGGCCGCTCTGGCCGCAGCAGCGGCCTCAGCCCTCCAGTCCACCTTCGTCTCCCCTAAT
CGCGACCTCGCCTTTGCCCTCTCGGTTCCAGACACAGACAATACCGACATCTTCTTCAGCATCCGAGCCCCCATC
TCCTACGCCTGGGCTGCCGTCGGTCTCGGAAGCGATGACATGAAGGGTGCCCTCTTCCTCATCATCTACCGCAAC
AAGCACCGCGACAACGTCACCCTCTCCCCGCGCCTCGCCTACGGCAACTACGAGCCCCAGCACTACCCAGACATG
CAGTACGACGTGCTGCCGGGCTCGGGCATCGACGGCGATCACATGGTACTTAATGCCCGGTGCACGCAGCACTGT
CGCAGCTGGCCGGCTGCCGACTCGAACAGCGGATATATGGATGTGTCGTCGGCGTCGGGGAAGGCTATCTTTGCC
ATGGGGCCGCGTGCTGGCTTTGGGAGTGATAGCCCGGCTGCTGATTTGCAGTTCCATCGCGAGTTTGGCGTCTTC
TCCATTGATATCAAGAGGACGCTTGGTGCTCCTGATCCGCCCAAGTTGGAAGATGACTCTGAGTCTGTGGGAACC
TCACTGGATTACCGCCGTACCGGACGTCGTGAGCCTCGGTCTAGTCTTCACGGTTCCTTCATGGTATTTTCCGTC
GTCTTTCTTTTGCCTGTTGGTGCTGCTCTGCGCAGTTCAGAACGCTGGGCTCGCTTCCACTCCCTCTGCCAGTCC
ATGGCCGTCCTCATCATGCTGGCTGGCGTCGTTACTGGTGTTCTGGCCAGTTTCCGCTACCAGAGGTCACGGAAC
TTTCGCGCTCATCATCAGATCATTGGCTTCATCGTCGTCGGCTTCGTTCTCGCTCAGCTCGTCCTTGGCTTCCTT
CACCAACGGAAGATGCGCAAGACGAATATGCCGACGAATCAGGGCCGCTATCATCGCTACCTAGGCGGTGCCATC
ATCATCTTCGGCGTCCTCAACGCCTTCTTTGGCTTCGACTTAGCCCTCGATTACAAATTGGGCTACACGCTCTGC
GGCTTCGTCCTCATCTCCGTCTTCGTCGTCCTCTTTCTCTACCTCAGTCGCCGCGGCGTACGCGGGAGGAGACAG
CGGCAGACGGCTACCACAGCGGACGGTCCGTCGACAGGATACCAGCCGCAGCCGTGGCGCGAGGAGCCGAATCCG
CCGGATGCGCCGCCCAGTTACGACGCTGCTTCGTCGCAGTATATCAGTCTGCAGCCTGTTCCCTCGCGGGCTTCG
CCTTGGCGGGGCTCGGATGTCAAGGACGGGGGGGATGATCAGCCGGCTTTGGGTGGTTTGCAGCGGCCTAGGGAG
TTTACGTAG
Transcript >Ophcf2|05454
ATGAGGCTCGCGCTCACGGCCGCTCTGGCCGCAGCAGCGGCCTCAGCCCTCCAGTCCACCTTCGTCTCCCCTAAT
CGCGACCTCGCCTTTGCCCTCTCGGTTCCAGACACAGACAATACCGACATCTTCTTCAGCATCCGAGCCCCCATC
TCCTACGCCTGGGCTGCCGTCGGTCTCGGAAGCGATGACATGAAGGGTGCCCTCTTCCTCATCATCTACCGCAAC
AAGCACCGCGACAACGTCACCCTCTCCCCGCGCCTCGCCTACGGCAACTACGAGCCCCAGCACTACCCAGACATG
CAGTACGACGTGCTGCCGGGCTCGGGCATCGACGGCGATCACATGGTACTTAATGCCCGGTGCACGCAGCACTGT
CGCAGCTGGCCGGCTGCCGACTCGAACAGCGGATATATGGATGTGTCGTCGGCGTCGGGGAAGGCTATCTTTGCC
ATGGGGCCGCGTGCTGGCTTTGGGAGTGATAGCCCGGCTGCTGATTTGCAGTTCCATCGCGAGTTTGGCGTCTTC
TCCATTGATATCAAGAGGACGCTTGGTGCTCCTGATCCGCCCAAGTTGGAAGATGACTCTGAGTCTGTGGGAACC
TCACTGGATTACCGCCGTACCGGACGTCGTGAGCCTCGGTCTAGTCTTCACGGTTCCTTCATGGTATTTTCCGTC
GTCTTTCTTTTGCCTGTTGGTGCTGCTCTGCGCAGTTCAGAACGCTGGGCTCGCTTCCACTCCCTCTGCCAGTCC
ATGGCCGTCCTCATCATGCTGGCTGGCGTCGTTACTGGTGTTCTGGCCAGTTTCCGCTACCAGAGGTCACGGAAC
TTTCGCGCTCATCATCAGATCATTGGCTTCATCGTCGTCGGCTTCGTTCTCGCTCAGCTCGTCCTTGGCTTCCTT
CACCAACGGAAGATGCGCAAGACGAATATGCCGACGAATCAGGGCCGCTATCATCGCTACCTAGGCGGTGCCATC
ATCATCTTCGGCGTCCTCAACGCCTTCTTTGGCTTCGACTTAGCCCTCGATTACAAATTGGGCTACACGCTCTGC
GGCTTCGTCCTCATCTCCGTCTTCGTCGTCCTCTTTCTCTACCTCAGTCGCCGCGGCGTACGCGGGAGGAGACAG
CGGCAGACGGCTACCACAGCGGACGGTCCGTCGACAGGATACCAGCCGCAGCCGTGGCGCGAGGAGCCGAATCCG
CCGGATGCGCCGCCCAGTTACGACGCTGCTTCGTCGCAGTATATCAGTCTGCAGCCTGTTCCCTCGCGGGCTTCG
CCTTGGCGGGGCTCGGATGTCAAGGACGGGGGGGATGATCAGCCGGCTTTGGGTGGTTTGCAGCGGCCTAGGGAG
TTTACGTAG
Gene >Ophcf2|05454
ATGAGGCTCGCGCTCACGGCCGCTCTGGCCGCAGCAGGTGAGACGCCAGCTTCAGACGCAGATGACGATGACGAC
GACGGCTAATCTCGAACCTCTACAGCGGCCTCAGCCCTCCAGTCCACCTTCGTCTCCCCTAATCGCGACCTCGCC
TTTGCCCTCTCGGTTCCAGACACAGACAATACCGACATCTTCTTCAGCATCCGAGCCCCCATCTCCTACGCCTGG
GCTGCCGTCGGTCTCGGAAGCGATGACATGAAGGGTGCCCTCTTCCTCATCATCTACCGCAACAAGCACCGCGAC
AACGTCACCCTCTCCCCGCGCCTCGCCTACGGCAACTACGAGCCCCAGCACTACCCAGACATGCAGTACGACGTG
CTGCCGGGCTCGGGCATCGACGGCGATCACATGGTACTTAATGCCCGGTGCACGCAGCACTGTCGCAGCTGGCCG
GCTGCCGACTCGAACAGCGGATATATGGATGTGTCGTCGGCGTCGGGGAAGGCTATCTTTGCCATGGGGCCGCGT
GCTGGCTTTGGGAGTGATAGCCCGGCTGCTGATTTGCAGTTCCATCGCGAGTTTGGCGTCTTCTCCATTGATATC
AAGAGGACGCTTGGTGCTCCTGATCCGCCCAAGTTGGAAGATGACTCTGAGTCTGTGGGAACCTCACTGGATTAC
CGCCGTACCGGACGTCGTGAGCCTCGGTCTAGTCTTCACGGTTCCTTCATGGTATTTTCCGTCGTCTTTCTTTTG
CCTGTTGGTGCTGCTCTGCGCAGTTCAGAACGCTGGGCTCGCTTCCACTCCCTCTGCCAGTCCATGGCCGTCCTC
ATCATGCTGGCTGGCGTCGTTACTGGTGTTCTGGCCAGTTTCCGCTACCAGAGGGTGCGCCTGATGATTGTCCTA
CCCCTTCCTGCATAATGTACTCACGCGCGTCTAGTCACGGAACTTTCGCGCTCATCATCAGATCATTGGCTTCAT
CGTCGTCGGCTTCGTTCTCGCTCAGCTCGTCCTTGGCTTCCTTCACCAACGGAAGATGCGCAAGACGAATATGCC
GACGAATCAGGGCCGCTATCATCGCTACCTAGGCGGTGCCATCATCATCTTCGGCGTCCTCAACGCCTTCTTGTG
CGTCTATTCCCCCGCTGATCCCCTTCTAAAGAGCATCTCGCTCACGCTACAGCCCCATAGTGGCTTCGACTTAGC
CCTCGATTACAAATTGGGCTACACGCTCTGCGGCTTCGTCCTCATCTCCGTCTTCGTCGTCCTCTTTCTCTACCT
CAGTCGCCGCGGCGTACGCGGGAGGAGACAGCGGCAGACGGCTACCACAGCGGACGGTCCGTCGACAGGATACCA
GCCGCAGCCGTGGCGCGAGGAGCCGAATCCGCCGGATGCGCCGCCCAGTTACGACGCTGCTTCGTCGCAGTATAT
CAGTCTGCAGCCTGTTCCCTCGCGGGCTTCGCCTTGGCGGGGCTCGGATGTCAAGGACGGGGGGGATGATCAGCC
GGCTTTGGGTGGTTTGCAGCGGCCTAGGGAGTTTACGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail