Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05454
Gene name
Locationscaffold_06:203341..204881
Strand+
Gene length (bp)1540
Transcript length (bp)1359
Coding sequence length (bp)1359
Protein length (aa) 453

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16010 CDH-cyt Cytochrome domain of cellobiose dehydrogenase 2.5E-23 20 181
PF03188 Cytochrom_B561 Eukaryotic cytochrome b561 4.6E-09 236 337

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 215 237 22
2 244 266 22
3 281 300 19
4 320 337 17
5 347 366 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05454
MRLALTAALAAAAASALQSTFVSPNRDLAFALSVPDTDNTDIFFSIRAPISYAWAAVGLGSDDMKGALFLIIYRN
KHRDNVTLSPRLAYGNYEPQHYPDMQYDVLPGSGIDGDHMVLNARCTQHCRSWPAADSNSGYMDVSSASGKAIFA
MGPRAGFGSDSPAADLQFHREFGVFSIDIKRTLGAPDPPKLEDDSESVGTSLDYRRTGRREPRSSLHGSFMVFSV
VFLLPVGAALRSSERWARFHSLCQSMAVLIMLAGVVTGVLASFRYQRSRNFRAHHQIIGFIVVGFVLAQLVLGFL
HQRKMRKTNMPTNQGRYHRYLGGAIIIFGVLNAFFGFDLALDYKLGYTLCGFVLISVFVVLFLYLSRRGVRGRRQ
RQTATTADGPSTGYQPQPWREEPNPPDAPPSYDAASSQYISLQPVPSRASPWRGSDVKDGGDDQPALGGLQRPRE
FT*
Coding >Ophcf2|05454
ATGAGGCTCGCGCTCACGGCCGCTCTGGCCGCAGCAGCGGCCTCAGCCCTCCAGTCCACCTTCGTCTCCCCTAAT
CGCGACCTCGCCTTTGCCCTCTCGGTTCCAGACACAGACAATACCGACATCTTCTTCAGCATCCGAGCCCCCATC
TCCTACGCCTGGGCTGCCGTCGGTCTCGGAAGCGATGACATGAAGGGTGCCCTCTTCCTCATCATCTACCGCAAC
AAGCACCGCGACAACGTCACCCTCTCCCCGCGCCTCGCCTACGGCAACTACGAGCCCCAGCACTACCCAGACATG
CAGTACGACGTGCTGCCGGGCTCGGGCATCGACGGCGATCACATGGTACTTAATGCCCGGTGCACGCAGCACTGT
CGCAGCTGGCCGGCTGCCGACTCGAACAGCGGATATATGGATGTGTCGTCGGCGTCGGGGAAGGCTATCTTTGCC
ATGGGGCCGCGTGCTGGCTTTGGGAGTGATAGCCCGGCTGCTGATTTGCAGTTCCATCGCGAGTTTGGCGTCTTC
TCCATTGATATCAAGAGGACGCTTGGTGCTCCTGATCCGCCCAAGTTGGAAGATGACTCTGAGTCTGTGGGAACC
TCACTGGATTACCGCCGTACCGGACGTCGTGAGCCTCGGTCTAGTCTTCACGGTTCCTTCATGGTATTTTCCGTC
GTCTTTCTTTTGCCTGTTGGTGCTGCTCTGCGCAGTTCAGAACGCTGGGCTCGCTTCCACTCCCTCTGCCAGTCC
ATGGCCGTCCTCATCATGCTGGCTGGCGTCGTTACTGGTGTTCTGGCCAGTTTCCGCTACCAGAGGTCACGGAAC
TTTCGCGCTCATCATCAGATCATTGGCTTCATCGTCGTCGGCTTCGTTCTCGCTCAGCTCGTCCTTGGCTTCCTT
CACCAACGGAAGATGCGCAAGACGAATATGCCGACGAATCAGGGCCGCTATCATCGCTACCTAGGCGGTGCCATC
ATCATCTTCGGCGTCCTCAACGCCTTCTTTGGCTTCGACTTAGCCCTCGATTACAAATTGGGCTACACGCTCTGC
GGCTTCGTCCTCATCTCCGTCTTCGTCGTCCTCTTTCTCTACCTCAGTCGCCGCGGCGTACGCGGGAGGAGACAG
CGGCAGACGGCTACCACAGCGGACGGTCCGTCGACAGGATACCAGCCGCAGCCGTGGCGCGAGGAGCCGAATCCG
CCGGATGCGCCGCCCAGTTACGACGCTGCTTCGTCGCAGTATATCAGTCTGCAGCCTGTTCCCTCGCGGGCTTCG
CCTTGGCGGGGCTCGGATGTCAAGGACGGGGGGGATGATCAGCCGGCTTTGGGTGGTTTGCAGCGGCCTAGGGAG
TTTACGTAG
Transcript >Ophcf2|05454
ATGAGGCTCGCGCTCACGGCCGCTCTGGCCGCAGCAGCGGCCTCAGCCCTCCAGTCCACCTTCGTCTCCCCTAAT
CGCGACCTCGCCTTTGCCCTCTCGGTTCCAGACACAGACAATACCGACATCTTCTTCAGCATCCGAGCCCCCATC
TCCTACGCCTGGGCTGCCGTCGGTCTCGGAAGCGATGACATGAAGGGTGCCCTCTTCCTCATCATCTACCGCAAC
AAGCACCGCGACAACGTCACCCTCTCCCCGCGCCTCGCCTACGGCAACTACGAGCCCCAGCACTACCCAGACATG
CAGTACGACGTGCTGCCGGGCTCGGGCATCGACGGCGATCACATGGTACTTAATGCCCGGTGCACGCAGCACTGT
CGCAGCTGGCCGGCTGCCGACTCGAACAGCGGATATATGGATGTGTCGTCGGCGTCGGGGAAGGCTATCTTTGCC
ATGGGGCCGCGTGCTGGCTTTGGGAGTGATAGCCCGGCTGCTGATTTGCAGTTCCATCGCGAGTTTGGCGTCTTC
TCCATTGATATCAAGAGGACGCTTGGTGCTCCTGATCCGCCCAAGTTGGAAGATGACTCTGAGTCTGTGGGAACC
TCACTGGATTACCGCCGTACCGGACGTCGTGAGCCTCGGTCTAGTCTTCACGGTTCCTTCATGGTATTTTCCGTC
GTCTTTCTTTTGCCTGTTGGTGCTGCTCTGCGCAGTTCAGAACGCTGGGCTCGCTTCCACTCCCTCTGCCAGTCC
ATGGCCGTCCTCATCATGCTGGCTGGCGTCGTTACTGGTGTTCTGGCCAGTTTCCGCTACCAGAGGTCACGGAAC
TTTCGCGCTCATCATCAGATCATTGGCTTCATCGTCGTCGGCTTCGTTCTCGCTCAGCTCGTCCTTGGCTTCCTT
CACCAACGGAAGATGCGCAAGACGAATATGCCGACGAATCAGGGCCGCTATCATCGCTACCTAGGCGGTGCCATC
ATCATCTTCGGCGTCCTCAACGCCTTCTTTGGCTTCGACTTAGCCCTCGATTACAAATTGGGCTACACGCTCTGC
GGCTTCGTCCTCATCTCCGTCTTCGTCGTCCTCTTTCTCTACCTCAGTCGCCGCGGCGTACGCGGGAGGAGACAG
CGGCAGACGGCTACCACAGCGGACGGTCCGTCGACAGGATACCAGCCGCAGCCGTGGCGCGAGGAGCCGAATCCG
CCGGATGCGCCGCCCAGTTACGACGCTGCTTCGTCGCAGTATATCAGTCTGCAGCCTGTTCCCTCGCGGGCTTCG
CCTTGGCGGGGCTCGGATGTCAAGGACGGGGGGGATGATCAGCCGGCTTTGGGTGGTTTGCAGCGGCCTAGGGAG
TTTACGTAG
Gene >Ophcf2|05454
ATGAGGCTCGCGCTCACGGCCGCTCTGGCCGCAGCAGGTGAGACGCCAGCTTCAGACGCAGATGACGATGACGAC
GACGGCTAATCTCGAACCTCTACAGCGGCCTCAGCCCTCCAGTCCACCTTCGTCTCCCCTAATCGCGACCTCGCC
TTTGCCCTCTCGGTTCCAGACACAGACAATACCGACATCTTCTTCAGCATCCGAGCCCCCATCTCCTACGCCTGG
GCTGCCGTCGGTCTCGGAAGCGATGACATGAAGGGTGCCCTCTTCCTCATCATCTACCGCAACAAGCACCGCGAC
AACGTCACCCTCTCCCCGCGCCTCGCCTACGGCAACTACGAGCCCCAGCACTACCCAGACATGCAGTACGACGTG
CTGCCGGGCTCGGGCATCGACGGCGATCACATGGTACTTAATGCCCGGTGCACGCAGCACTGTCGCAGCTGGCCG
GCTGCCGACTCGAACAGCGGATATATGGATGTGTCGTCGGCGTCGGGGAAGGCTATCTTTGCCATGGGGCCGCGT
GCTGGCTTTGGGAGTGATAGCCCGGCTGCTGATTTGCAGTTCCATCGCGAGTTTGGCGTCTTCTCCATTGATATC
AAGAGGACGCTTGGTGCTCCTGATCCGCCCAAGTTGGAAGATGACTCTGAGTCTGTGGGAACCTCACTGGATTAC
CGCCGTACCGGACGTCGTGAGCCTCGGTCTAGTCTTCACGGTTCCTTCATGGTATTTTCCGTCGTCTTTCTTTTG
CCTGTTGGTGCTGCTCTGCGCAGTTCAGAACGCTGGGCTCGCTTCCACTCCCTCTGCCAGTCCATGGCCGTCCTC
ATCATGCTGGCTGGCGTCGTTACTGGTGTTCTGGCCAGTTTCCGCTACCAGAGGGTGCGCCTGATGATTGTCCTA
CCCCTTCCTGCATAATGTACTCACGCGCGTCTAGTCACGGAACTTTCGCGCTCATCATCAGATCATTGGCTTCAT
CGTCGTCGGCTTCGTTCTCGCTCAGCTCGTCCTTGGCTTCCTTCACCAACGGAAGATGCGCAAGACGAATATGCC
GACGAATCAGGGCCGCTATCATCGCTACCTAGGCGGTGCCATCATCATCTTCGGCGTCCTCAACGCCTTCTTGTG
CGTCTATTCCCCCGCTGATCCCCTTCTAAAGAGCATCTCGCTCACGCTACAGCCCCATAGTGGCTTCGACTTAGC
CCTCGATTACAAATTGGGCTACACGCTCTGCGGCTTCGTCCTCATCTCCGTCTTCGTCGTCCTCTTTCTCTACCT
CAGTCGCCGCGGCGTACGCGGGAGGAGACAGCGGCAGACGGCTACCACAGCGGACGGTCCGTCGACAGGATACCA
GCCGCAGCCGTGGCGCGAGGAGCCGAATCCGCCGGATGCGCCGCCCAGTTACGACGCTGCTTCGTCGCAGTATAT
CAGTCTGCAGCCTGTTCCCTCGCGGGCTTCGCCTTGGCGGGGCTCGGATGTCAAGGACGGGGGGGATGATCAGCC
GGCTTTGGGTGGTTTGCAGCGGCCTAGGGAGTTTACGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail