Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05450
Gene name
Locationscaffold_06:194454..197286
Strand-
Gene length (bp)2832
Transcript length (bp)2832
Coding sequence length (bp)2832
Protein length (aa) 944

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02194 PXA PXA domain 8.4E-34 132 308
PF08628 Nexin_C Sorting nexin C terminal 6.4E-20 807 923
PF00787 PX PX domain 3.0E-05 489 564

GO

GO Term Description Terminal node
GO:0035091 phosphatidylinositol binding Yes
GO:0005543 phospholipid binding No
GO:0008289 lipid binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.5

Transmembrane Domains

Domain # Start End Length
1 33 55 22
2 60 82 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05450
MAGPHVRPAAAPDPPPRFDSDSRSPSQQLSAKALHFISVASPGTLAGIAVAFSGVTYAILGRLGLLVIGAVGGVI
AFASLEAKHPDVGRAVRGEKGPEVLNRLWADLQNTTSSSALDADDDGQLKAFDDFRPETREALSAFVDAIIRDYV
KWWYSPLVPTDHSFPLACRKTLNAYVMAISNRLSRKRPADAFLDLLTNCSSIIIVFMSELAAAYADLPPDTNMTA
ADAIYNYLASNPDSRLASLLNQRQQAAKFKMVAEDLLVFLEQAPQSCDPARVFLREILANSVLETTLQSCSKAEW
INGWIVHLLEAGEPDLNQAIDVGMQTGHDNNVFADLDGNVGNIGIAKPGRSSPEVERSRRKDSSGHSSSSSSSKS
PPRRDEAQAHGEVDSTSTPSRWSMAGSSRDSPSPSAAAANRSSGQQFTSFDQIVAHGSGQAAEQEAPKKEQLHLH
NASFTLHDDTTGDGGKIRNKPNWDYLIQVEPSLAVIPGWMIVRRYSDFETLHEILRRIATVSGATAFTELHKELP
GWKMHTRESLRGELERYLRDACWYASLAESEGMKRFLEKSQGHTHGGSKSFGWETVGKNMLDALTIGPKGAVEGG
KNLVGVLGGFPGLGRKPTNPLSAVDVGGAGPAGRLSRSNPSPVAKSPARSERASTDSQRSSVISTQPGKVAPMDR
RASHQLDSDAVDYTRVGRSDRTDSGSSSAHPSREHSRASSLAPVQSPSMSSIDMMKLPPPPDEVEDDYVGLGDGS
PPQHDRRRSSIMTNGGKKPPPLRPSRQYSQLSEQETRVAVELLFAVINEMYTLSSAWNIRRTLLTAAKSFLLRPG
NPSLLTVQSLIQSSLLDANTSDAGIASTVRKLRENSLPTDAERASWPQDLSADDKDKLAVKARRMLVQRGVPAAL
MGVMGQAATGDALGRVFDCLQIEEVARGLVFGLMLQMVRIVTH*
Coding >Ophcf2|05450
ATGGCCGGCCCCCATGTGCGACCTGCAGCTGCCCCTGATCCGCCACCTCGCTTCGACAGCGACTCCCGAAGCCCC
TCGCAGCAACTGAGCGCAAAAGCCCTTCACTTCATATCGGTCGCCTCGCCAGGCACCCTGGCCGGCATCGCAGTC
GCCTTCTCCGGCGTCACTTACGCCATACTCGGTCGGCTGGGTCTGCTGGTTATTGGCGCTGTCGGTGGCGTCATC
GCTTTTGCGTCTCTCGAGGCCAAGCATCCAGACGTGGGCAGGGCTGTTCGAGGCGAAAAAGGACCCGAAGTCCTC
AACCGGCTTTGGGCTGACCTGCAGAATACGACCTCTTCGTCGGCTCTCGACGCCGATGACGATGGGCAGCTCAAG
GCCTTTGACGACTTCCGTCCCGAGACGCGCGAGGCACTCTCGGCCTTTGTCGACGCCATTATCCGCGACTACGTC
AAGTGGTGGTACAGTCCCCTTGTGCCCACCGACCACTCGTTTCCCCTGGCCTGTCGCAAGACGCTCAACGCCTAC
GTCATGGCCATATCCAACCGCCTGTCTCGCAAACGCCCCGCCGACGCCTTCCTCGACCTCCTCACCAACTGCTCG
TCCATCATCATCGTCTTCATGTCCGAGCTCGCCGCCGCCTACGCAGACCTCCCCCCCGATACGAACATGACGGCC
GCTGATGCCATATACAACTACCTGGCCTCCAATCCCGACTCGCGCCTGGCCAGTCTCCTCAACCAGCGCCAGCAG
GCCGCCAAGTTTAAGATGGTGGCCGAGGACCTGCTGGTCTTTCTTGAGCAGGCGCCTCAGAGCTGCGACCCTGCC
CGCGTTTTTCTCCGCGAGATCCTGGCCAACTCGGTGCTCGAGACGACGCTGCAGTCTTGCAGCAAAGCCGAGTGG
ATCAATGGCTGGATCGTCCACCTCCTCGAAGCCGGCGAACCTGATCTCAATCAGGCCATCGACGTCGGCATGCAG
ACTGGCCACGATAACAACGTCTTCGCCGACCTCGACGGCAACGTCGGTAATATTGGCATTGCCAAGCCCGGTCGG
TCGAGCCCGGAGGTGGAACGCAGCCGGCGAAAAGACTCGTCCGGCCACAGCAGCAGCAGCAGCAGTAGCAAGAGT
CCGCCCCGACGTGACGAGGCTCAGGCTCACGGCGAGGTCGATAGCACGTCGACGCCCTCTCGTTGGTCCATGGCC
GGCTCCAGCCGGGACTCACCCTCTCCCTCTGCTGCCGCAGCCAACAGGTCGAGCGGACAGCAGTTTACGAGTTTC
GACCAGATCGTCGCACACGGATCGGGACAGGCGGCAGAGCAAGAGGCACCCAAAAAAGAGCAGCTTCATCTGCAC
AATGCGTCCTTTACCTTGCATGACGACACGACGGGTGACGGCGGCAAGATACGCAACAAGCCCAACTGGGACTAC
TTGATCCAGGTCGAACCGTCGTTGGCCGTGATTCCGGGCTGGATGATTGTCAGAAGATACTCGGATTTCGAGACA
CTACACGAGATCCTGCGGCGCATCGCCACCGTCTCGGGCGCCACGGCTTTTACCGAGCTACACAAGGAGCTGCCC
GGATGGAAGATGCACACGCGCGAGTCGCTGCGAGGCGAGCTGGAGCGGTACCTGCGAGACGCCTGCTGGTACGCG
TCGCTTGCCGAGAGCGAGGGAATGAAGCGCTTCCTGGAGAAGTCACAGGGACACACGCACGGAGGGTCCAAGTCC
TTCGGATGGGAGACGGTGGGAAAGAACATGCTAGACGCGCTGACCATCGGCCCCAAGGGCGCCGTCGAGGGCGGG
AAGAATCTGGTGGGAGTCCTCGGTGGCTTCCCGGGCCTCGGTCGGAAGCCGACGAACCCACTGTCGGCAGTCGAC
GTCGGAGGAGCGGGGCCGGCCGGCCGGCTCTCACGGTCCAACCCATCACCGGTGGCCAAATCGCCGGCGCGATCG
GAACGGGCCAGCACCGACAGCCAGCGGTCATCCGTCATCTCAACGCAACCCGGTAAAGTAGCGCCGATGGACAGA
AGAGCAAGCCACCAGCTCGACTCGGACGCCGTCGACTACACGCGCGTGGGCCGCTCCGACCGCACCGATTCGGGC
TCCAGCAGCGCGCATCCCAGCCGCGAACATAGCAGGGCATCCAGCCTCGCGCCGGTCCAGTCCCCGTCCATGTCG
AGCATCGACATGATGAAGCTCCCGCCACCGCCAGACGAGGTGGAAGACGACTACGTCGGTCTCGGCGACGGCTCT
CCTCCTCAACACGACCGCCGACGAAGCAGCATCATGACCAACGGTGGCAAGAAGCCCCCCCCCCTCCGTCCATCA
CGACAATACTCGCAACTCTCAGAACAAGAAACCCGCGTCGCGGTCGAACTCCTCTTCGCCGTCATCAACGAAATG
TACACCCTCTCCTCAGCCTGGAACATCCGCCGCACCCTCCTGACGGCGGCAAAATCGTTCCTCCTCCGCCCCGGA
AACCCCTCCCTCCTAACCGTCCAATCCCTCATCCAATCCTCCCTCCTCGACGCAAACACCTCGGACGCAGGGATA
GCATCCACCGTCCGCAAACTCCGCGAAAACAGCCTCCCCACCGACGCAGAGCGCGCCTCGTGGCCCCAAGACCTC
TCCGCCGACGACAAGGACAAGCTGGCGGTCAAGGCGCGCCGCATGCTCGTCCAGAGGGGCGTCCCCGCCGCTCTC
ATGGGCGTCATGGGCCAGGCCGCCACGGGGGATGCGCTGGGTAGGGTCTTTGATTGCTTGCAGATTGAGGAGGTG
GCTAGGGGTTTGGTCTTTGGCTTGATGTTGCAGATGGTTCGCATCGTGACGCATTGA
Transcript >Ophcf2|05450
ATGGCCGGCCCCCATGTGCGACCTGCAGCTGCCCCTGATCCGCCACCTCGCTTCGACAGCGACTCCCGAAGCCCC
TCGCAGCAACTGAGCGCAAAAGCCCTTCACTTCATATCGGTCGCCTCGCCAGGCACCCTGGCCGGCATCGCAGTC
GCCTTCTCCGGCGTCACTTACGCCATACTCGGTCGGCTGGGTCTGCTGGTTATTGGCGCTGTCGGTGGCGTCATC
GCTTTTGCGTCTCTCGAGGCCAAGCATCCAGACGTGGGCAGGGCTGTTCGAGGCGAAAAAGGACCCGAAGTCCTC
AACCGGCTTTGGGCTGACCTGCAGAATACGACCTCTTCGTCGGCTCTCGACGCCGATGACGATGGGCAGCTCAAG
GCCTTTGACGACTTCCGTCCCGAGACGCGCGAGGCACTCTCGGCCTTTGTCGACGCCATTATCCGCGACTACGTC
AAGTGGTGGTACAGTCCCCTTGTGCCCACCGACCACTCGTTTCCCCTGGCCTGTCGCAAGACGCTCAACGCCTAC
GTCATGGCCATATCCAACCGCCTGTCTCGCAAACGCCCCGCCGACGCCTTCCTCGACCTCCTCACCAACTGCTCG
TCCATCATCATCGTCTTCATGTCCGAGCTCGCCGCCGCCTACGCAGACCTCCCCCCCGATACGAACATGACGGCC
GCTGATGCCATATACAACTACCTGGCCTCCAATCCCGACTCGCGCCTGGCCAGTCTCCTCAACCAGCGCCAGCAG
GCCGCCAAGTTTAAGATGGTGGCCGAGGACCTGCTGGTCTTTCTTGAGCAGGCGCCTCAGAGCTGCGACCCTGCC
CGCGTTTTTCTCCGCGAGATCCTGGCCAACTCGGTGCTCGAGACGACGCTGCAGTCTTGCAGCAAAGCCGAGTGG
ATCAATGGCTGGATCGTCCACCTCCTCGAAGCCGGCGAACCTGATCTCAATCAGGCCATCGACGTCGGCATGCAG
ACTGGCCACGATAACAACGTCTTCGCCGACCTCGACGGCAACGTCGGTAATATTGGCATTGCCAAGCCCGGTCGG
TCGAGCCCGGAGGTGGAACGCAGCCGGCGAAAAGACTCGTCCGGCCACAGCAGCAGCAGCAGCAGTAGCAAGAGT
CCGCCCCGACGTGACGAGGCTCAGGCTCACGGCGAGGTCGATAGCACGTCGACGCCCTCTCGTTGGTCCATGGCC
GGCTCCAGCCGGGACTCACCCTCTCCCTCTGCTGCCGCAGCCAACAGGTCGAGCGGACAGCAGTTTACGAGTTTC
GACCAGATCGTCGCACACGGATCGGGACAGGCGGCAGAGCAAGAGGCACCCAAAAAAGAGCAGCTTCATCTGCAC
AATGCGTCCTTTACCTTGCATGACGACACGACGGGTGACGGCGGCAAGATACGCAACAAGCCCAACTGGGACTAC
TTGATCCAGGTCGAACCGTCGTTGGCCGTGATTCCGGGCTGGATGATTGTCAGAAGATACTCGGATTTCGAGACA
CTACACGAGATCCTGCGGCGCATCGCCACCGTCTCGGGCGCCACGGCTTTTACCGAGCTACACAAGGAGCTGCCC
GGATGGAAGATGCACACGCGCGAGTCGCTGCGAGGCGAGCTGGAGCGGTACCTGCGAGACGCCTGCTGGTACGCG
TCGCTTGCCGAGAGCGAGGGAATGAAGCGCTTCCTGGAGAAGTCACAGGGACACACGCACGGAGGGTCCAAGTCC
TTCGGATGGGAGACGGTGGGAAAGAACATGCTAGACGCGCTGACCATCGGCCCCAAGGGCGCCGTCGAGGGCGGG
AAGAATCTGGTGGGAGTCCTCGGTGGCTTCCCGGGCCTCGGTCGGAAGCCGACGAACCCACTGTCGGCAGTCGAC
GTCGGAGGAGCGGGGCCGGCCGGCCGGCTCTCACGGTCCAACCCATCACCGGTGGCCAAATCGCCGGCGCGATCG
GAACGGGCCAGCACCGACAGCCAGCGGTCATCCGTCATCTCAACGCAACCCGGTAAAGTAGCGCCGATGGACAGA
AGAGCAAGCCACCAGCTCGACTCGGACGCCGTCGACTACACGCGCGTGGGCCGCTCCGACCGCACCGATTCGGGC
TCCAGCAGCGCGCATCCCAGCCGCGAACATAGCAGGGCATCCAGCCTCGCGCCGGTCCAGTCCCCGTCCATGTCG
AGCATCGACATGATGAAGCTCCCGCCACCGCCAGACGAGGTGGAAGACGACTACGTCGGTCTCGGCGACGGCTCT
CCTCCTCAACACGACCGCCGACGAAGCAGCATCATGACCAACGGTGGCAAGAAGCCCCCCCCCCTCCGTCCATCA
CGACAATACTCGCAACTCTCAGAACAAGAAACCCGCGTCGCGGTCGAACTCCTCTTCGCCGTCATCAACGAAATG
TACACCCTCTCCTCAGCCTGGAACATCCGCCGCACCCTCCTGACGGCGGCAAAATCGTTCCTCCTCCGCCCCGGA
AACCCCTCCCTCCTAACCGTCCAATCCCTCATCCAATCCTCCCTCCTCGACGCAAACACCTCGGACGCAGGGATA
GCATCCACCGTCCGCAAACTCCGCGAAAACAGCCTCCCCACCGACGCAGAGCGCGCCTCGTGGCCCCAAGACCTC
TCCGCCGACGACAAGGACAAGCTGGCGGTCAAGGCGCGCCGCATGCTCGTCCAGAGGGGCGTCCCCGCCGCTCTC
ATGGGCGTCATGGGCCAGGCCGCCACGGGGGATGCGCTGGGTAGGGTCTTTGATTGCTTGCAGATTGAGGAGGTG
GCTAGGGGTTTGGTCTTTGGCTTGATGTTGCAGATGGTTCGCATCGTGACGCATTGA
Gene >Ophcf2|05450
ATGGCCGGCCCCCATGTGCGACCTGCAGCTGCCCCTGATCCGCCACCTCGCTTCGACAGCGACTCCCGAAGCCCC
TCGCAGCAACTGAGCGCAAAAGCCCTTCACTTCATATCGGTCGCCTCGCCAGGCACCCTGGCCGGCATCGCAGTC
GCCTTCTCCGGCGTCACTTACGCCATACTCGGTCGGCTGGGTCTGCTGGTTATTGGCGCTGTCGGTGGCGTCATC
GCTTTTGCGTCTCTCGAGGCCAAGCATCCAGACGTGGGCAGGGCTGTTCGAGGCGAAAAAGGACCCGAAGTCCTC
AACCGGCTTTGGGCTGACCTGCAGAATACGACCTCTTCGTCGGCTCTCGACGCCGATGACGATGGGCAGCTCAAG
GCCTTTGACGACTTCCGTCCCGAGACGCGCGAGGCACTCTCGGCCTTTGTCGACGCCATTATCCGCGACTACGTC
AAGTGGTGGTACAGTCCCCTTGTGCCCACCGACCACTCGTTTCCCCTGGCCTGTCGCAAGACGCTCAACGCCTAC
GTCATGGCCATATCCAACCGCCTGTCTCGCAAACGCCCCGCCGACGCCTTCCTCGACCTCCTCACCAACTGCTCG
TCCATCATCATCGTCTTCATGTCCGAGCTCGCCGCCGCCTACGCAGACCTCCCCCCCGATACGAACATGACGGCC
GCTGATGCCATATACAACTACCTGGCCTCCAATCCCGACTCGCGCCTGGCCAGTCTCCTCAACCAGCGCCAGCAG
GCCGCCAAGTTTAAGATGGTGGCCGAGGACCTGCTGGTCTTTCTTGAGCAGGCGCCTCAGAGCTGCGACCCTGCC
CGCGTTTTTCTCCGCGAGATCCTGGCCAACTCGGTGCTCGAGACGACGCTGCAGTCTTGCAGCAAAGCCGAGTGG
ATCAATGGCTGGATCGTCCACCTCCTCGAAGCCGGCGAACCTGATCTCAATCAGGCCATCGACGTCGGCATGCAG
ACTGGCCACGATAACAACGTCTTCGCCGACCTCGACGGCAACGTCGGTAATATTGGCATTGCCAAGCCCGGTCGG
TCGAGCCCGGAGGTGGAACGCAGCCGGCGAAAAGACTCGTCCGGCCACAGCAGCAGCAGCAGCAGTAGCAAGAGT
CCGCCCCGACGTGACGAGGCTCAGGCTCACGGCGAGGTCGATAGCACGTCGACGCCCTCTCGTTGGTCCATGGCC
GGCTCCAGCCGGGACTCACCCTCTCCCTCTGCTGCCGCAGCCAACAGGTCGAGCGGACAGCAGTTTACGAGTTTC
GACCAGATCGTCGCACACGGATCGGGACAGGCGGCAGAGCAAGAGGCACCCAAAAAAGAGCAGCTTCATCTGCAC
AATGCGTCCTTTACCTTGCATGACGACACGACGGGTGACGGCGGCAAGATACGCAACAAGCCCAACTGGGACTAC
TTGATCCAGGTCGAACCGTCGTTGGCCGTGATTCCGGGCTGGATGATTGTCAGAAGATACTCGGATTTCGAGACA
CTACACGAGATCCTGCGGCGCATCGCCACCGTCTCGGGCGCCACGGCTTTTACCGAGCTACACAAGGAGCTGCCC
GGATGGAAGATGCACACGCGCGAGTCGCTGCGAGGCGAGCTGGAGCGGTACCTGCGAGACGCCTGCTGGTACGCG
TCGCTTGCCGAGAGCGAGGGAATGAAGCGCTTCCTGGAGAAGTCACAGGGACACACGCACGGAGGGTCCAAGTCC
TTCGGATGGGAGACGGTGGGAAAGAACATGCTAGACGCGCTGACCATCGGCCCCAAGGGCGCCGTCGAGGGCGGG
AAGAATCTGGTGGGAGTCCTCGGTGGCTTCCCGGGCCTCGGTCGGAAGCCGACGAACCCACTGTCGGCAGTCGAC
GTCGGAGGAGCGGGGCCGGCCGGCCGGCTCTCACGGTCCAACCCATCACCGGTGGCCAAATCGCCGGCGCGATCG
GAACGGGCCAGCACCGACAGCCAGCGGTCATCCGTCATCTCAACGCAACCCGGTAAAGTAGCGCCGATGGACAGA
AGAGCAAGCCACCAGCTCGACTCGGACGCCGTCGACTACACGCGCGTGGGCCGCTCCGACCGCACCGATTCGGGC
TCCAGCAGCGCGCATCCCAGCCGCGAACATAGCAGGGCATCCAGCCTCGCGCCGGTCCAGTCCCCGTCCATGTCG
AGCATCGACATGATGAAGCTCCCGCCACCGCCAGACGAGGTGGAAGACGACTACGTCGGTCTCGGCGACGGCTCT
CCTCCTCAACACGACCGCCGACGAAGCAGCATCATGACCAACGGTGGCAAGAAGCCCCCCCCCCTCCGTCCATCA
CGACAATACTCGCAACTCTCAGAACAAGAAACCCGCGTCGCGGTCGAACTCCTCTTCGCCGTCATCAACGAAATG
TACACCCTCTCCTCAGCCTGGAACATCCGCCGCACCCTCCTGACGGCGGCAAAATCGTTCCTCCTCCGCCCCGGA
AACCCCTCCCTCCTAACCGTCCAATCCCTCATCCAATCCTCCCTCCTCGACGCAAACACCTCGGACGCAGGGATA
GCATCCACCGTCCGCAAACTCCGCGAAAACAGCCTCCCCACCGACGCAGAGCGCGCCTCGTGGCCCCAAGACCTC
TCCGCCGACGACAAGGACAAGCTGGCGGTCAAGGCGCGCCGCATGCTCGTCCAGAGGGGCGTCCCCGCCGCTCTC
ATGGGCGTCATGGGCCAGGCCGCCACGGGGGATGCGCTGGGTAGGGTCTTTGATTGCTTGCAGATTGAGGAGGTG
GCTAGGGGTTTGGTCTTTGGCTTGATGTTGCAGATGGTTCGCATCGTGACGCATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail