Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05447
Gene name
Locationscaffold_06:187430..188012
Strand-
Gene length (bp)582
Transcript length (bp)582
Coding sequence length (bp)582
Protein length (aa) 194

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.3404 0.1562 0.7356 0.0797 0.2415 0.2329 0.3851 0.4492 0.4518 0.0422

SignalP

SignalP signal predicted Location Score
Yes 1 - 25 0.997602

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5373
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|05447 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5179
Ophiocordyceps kimflemingae Ophio5|5396
Ophiocordyceps subramaniannii Hirsu2|5407
Ophiocordyceps subramaniannii Hirsu2|5421

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05447
MSINSFFSALACVWLTCSPEPPSLAELRNPRVSVEEARAIVNNLEVHIGPTARYPAVITVTVRNSNPHAVVFIKD
YSPLDPLALRLGMFNVTPAFYRAPLSLPRVRVRREWPPDVSALVSLQPGGTAFGSVNLHDLDMDFRPFGPMARVV
LFGKWHAVWKGSLVGTEVFGLEGWGAMQGEFVSNSFKLNLRNV*
Coding >Ophcf2|05447
ATGAGCATCAATTCGTTCTTCTCCGCCTTGGCCTGTGTATGGCTCACTTGTTCTCCTGAACCGCCTTCACTTGCC
GAGCTGCGGAACCCGCGAGTGAGCGTCGAAGAGGCACGCGCCATCGTGAACAACCTAGAGGTTCACATCGGACCA
ACAGCCAGATACCCAGCCGTCATCACCGTCACAGTCCGCAACTCCAACCCACACGCCGTCGTCTTCATCAAGGAT
TACTCACCGCTTGACCCCCTCGCCCTACGACTGGGCATGTTCAACGTCACGCCAGCCTTTTACCGCGCGCCGCTC
TCCCTTCCACGCGTCCGGGTTCGACGGGAGTGGCCTCCGGACGTCTCGGCCCTCGTCTCGCTTCAGCCCGGCGGC
ACCGCCTTCGGATCCGTCAACCTCCATGATCTAGACATGGATTTCCGGCCTTTTGGACCCATGGCTCGCGTCGTT
TTGTTTGGAAAGTGGCATGCTGTCTGGAAAGGAAGCCTCGTTGGCACCGAGGTCTTTGGGCTGGAAGGTTGGGGG
GCGATGCAGGGGGAGTTTGTGTCAAATAGCTTTAAGCTAAATCTGCGGAACGTGTAG
Transcript >Ophcf2|05447
ATGAGCATCAATTCGTTCTTCTCCGCCTTGGCCTGTGTATGGCTCACTTGTTCTCCTGAACCGCCTTCACTTGCC
GAGCTGCGGAACCCGCGAGTGAGCGTCGAAGAGGCACGCGCCATCGTGAACAACCTAGAGGTTCACATCGGACCA
ACAGCCAGATACCCAGCCGTCATCACCGTCACAGTCCGCAACTCCAACCCACACGCCGTCGTCTTCATCAAGGAT
TACTCACCGCTTGACCCCCTCGCCCTACGACTGGGCATGTTCAACGTCACGCCAGCCTTTTACCGCGCGCCGCTC
TCCCTTCCACGCGTCCGGGTTCGACGGGAGTGGCCTCCGGACGTCTCGGCCCTCGTCTCGCTTCAGCCCGGCGGC
ACCGCCTTCGGATCCGTCAACCTCCATGATCTAGACATGGATTTCCGGCCTTTTGGACCCATGGCTCGCGTCGTT
TTGTTTGGAAAGTGGCATGCTGTCTGGAAAGGAAGCCTCGTTGGCACCGAGGTCTTTGGGCTGGAAGGTTGGGGG
GCGATGCAGGGGGAGTTTGTGTCAAATAGCTTTAAGCTAAATCTGCGGAACGTGTAG
Gene >Ophcf2|05447
ATGAGCATCAATTCGTTCTTCTCCGCCTTGGCCTGTGTATGGCTCACTTGTTCTCCTGAACCGCCTTCACTTGCC
GAGCTGCGGAACCCGCGAGTGAGCGTCGAAGAGGCACGCGCCATCGTGAACAACCTAGAGGTTCACATCGGACCA
ACAGCCAGATACCCAGCCGTCATCACCGTCACAGTCCGCAACTCCAACCCACACGCCGTCGTCTTCATCAAGGAT
TACTCACCGCTTGACCCCCTCGCCCTACGACTGGGCATGTTCAACGTCACGCCAGCCTTTTACCGCGCGCCGCTC
TCCCTTCCACGCGTCCGGGTTCGACGGGAGTGGCCTCCGGACGTCTCGGCCCTCGTCTCGCTTCAGCCCGGCGGC
ACCGCCTTCGGATCCGTCAACCTCCATGATCTAGACATGGATTTCCGGCCTTTTGGACCCATGGCTCGCGTCGTT
TTGTTTGGAAAGTGGCATGCTGTCTGGAAAGGAAGCCTCGTTGGCACCGAGGTCTTTGGGCTGGAAGGTTGGGGG
GCGATGCAGGGGGAGTTTGTGTCAAATAGCTTTAAGCTAAATCTGCGGAACGTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail