Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05440
Gene name
Locationscaffold_06:141541..143528
Strand-
Gene length (bp)1987
Transcript length (bp)1821
Coding sequence length (bp)1821
Protein length (aa) 607

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01433 Peptidase_M1 Peptidase family M1 domain 4.5E-45 229 427
PF09127 Leuk-A4-hydro_C Leukotriene A4 hydrolase, C-terminal 8.6E-37 492 602
PF17900 Peptidase_M1_N Peptidase M1 N-terminal domain 5.4E-24 18 198

GO

GO Term Description Terminal node
GO:0008237 metallopeptidase activity Yes
GO:0008270 zinc ion binding Yes
GO:0043169 cation binding No
GO:0046914 transition metal ion binding No
GO:0003824 catalytic activity No
GO:0008233 peptidase activity No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0016787 hydrolase activity No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6613 0.4265 0.1617 0.0558 0.1041 0.0141 0.2275 0.0484 0.1231 0.0106

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1026
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4457
Ophiocordyceps australis map64 (Brazil) OphauB2|7104
Ophiocordyceps camponoti-floridani Ophcf2|05440 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5189
Ophiocordyceps kimflemingae Ophio5|7680
Ophiocordyceps subramaniannii Hirsu2|9292

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05440
MAHRDPSTASNYEAWRTRHTTVEFALDFDAKRLRGSVLLQLQSQTDRVSSEIVLDTRFVSVSSVQVNASQAAWEL
KPHVDPLGAPLHIAVPGGASKGDSVHVAIYLETTERCTALQWLTPAQTSGRKYPYVFSQCQAINARSIFPCQDTP
DIKSTYTFKLTSILPAVASGVAVGPDAPAPGVETVYQFEQKVPIPSYLFALASGDIVAAPIGSRSLVATGPNELA
DCKWELERDMDKFMQVAEKLIFPYRWGQYNVLVLPPSFPYGGMENPIYTYATPTIISGDRQNVDVIAHELSHSWS
GNLVTNASWEHFWLNEGWTVYLERRILGEMHGKAHFDFSAIIGWKGLEDAVKLFGKDHEYTKLVIRHDEADPEDV
YSQVAYEKGFHFLYELDRLVGRENFDKFIPHYFTEWSEKSLDSFEFRDTFVQFFKGLGDKEVINKVDAIDWEAKF
YTPGLPPKPDFDTSMVKACYDLAEKWGHDSFEPSAKDVESMTANQKLVFLDRVQQATALSAERAQQLGKVYDLIT
TKNAELKTAYYLVALKAHDPTCVYGVAELLGAVGRMKYVRPLFRELNKFKRQFALDTFARNKDFYHPICRGMVEK
DLGIHE*
Coding >Ophcf2|05440
ATGGCGCACCGCGATCCGTCGACGGCCTCCAACTACGAGGCCTGGCGTACGCGTCACACAACGGTGGAATTCGCC
CTCGACTTCGATGCCAAGCGCCTTCGAGGCTCCGTATTGCTGCAGCTGCAGAGCCAGACGGACCGAGTCAGCAGC
GAGATTGTTCTAGATACCCGCTTCGTCAGCGTGTCGTCGGTCCAGGTCAACGCTTCGCAGGCGGCGTGGGAGCTC
AAGCCTCATGTCGACCCTCTGGGTGCTCCCTTGCACATTGCCGTACCGGGCGGGGCTTCCAAGGGCGACTCGGTT
CATGTCGCTATTTATCTGGAGACGACGGAACGCTGCACGGCTCTGCAGTGGCTGACGCCTGCTCAGACGTCCGGC
CGCAAGTACCCCTACGTCTTTTCGCAGTGCCAGGCCATCAACGCTAGATCCATCTTTCCCTGTCAGGATACGCCC
GACATCAAGTCTACCTACACGTTCAAGTTGACGTCTATTCTTCCCGCTGTTGCTAGCGGAGTCGCCGTCGGCCCC
GATGCCCCCGCTCCTGGGGTCGAGACGGTCTACCAATTTGAGCAGAAAGTCCCCATCCCGTCGTATCTTTTTGCT
CTCGCTTCGGGAGACATCGTCGCCGCGCCTATCGGCTCTCGCAGTCTCGTTGCTACCGGACCCAATGAATTGGCC
GACTGCAAGTGGGAGCTTGAGCGAGACATGGACAAGTTTATGCAAGTTGCCGAGAAGCTCATCTTTCCCTACCGA
TGGGGCCAATATAATGTCCTCGTGCTGCCCCCCAGTTTTCCTTATGGCGGTATGGAAAATCCCATCTACACGTAC
GCCACGCCGACCATTATTAGTGGCGACCGTCAGAACGTCGACGTTATTGCCCATGAGCTTAGCCACAGCTGGAGC
GGCAATCTCGTGACAAATGCCAGCTGGGAGCACTTCTGGCTGAACGAAGGGTGGACCGTTTACCTGGAACGTCGG
ATCCTGGGCGAGATGCACGGAAAAGCACACTTTGACTTTTCGGCAATCATTGGTTGGAAGGGGCTTGAGGACGCC
GTCAAGTTGTTCGGCAAAGATCACGAGTACACCAAGCTGGTGATTCGCCACGACGAGGCCGACCCGGAGGATGTC
TACAGTCAGGTGGCTTACGAGAAGGGCTTCCACTTTCTGTACGAGTTGGATCGGCTGGTTGGGCGCGAGAATTTC
GACAAGTTCATCCCTCACTACTTTACTGAGTGGTCGGAAAAGTCGCTCGACTCGTTCGAGTTTCGCGACACGTTT
GTGCAGTTCTTCAAGGGTCTCGGCGACAAAGAGGTCATTAACAAGGTCGACGCAATCGACTGGGAGGCAAAGTTC
TACACGCCGGGGTTACCGCCGAAGCCGGACTTTGACACGTCGATGGTGAAGGCATGCTATGACTTGGCCGAGAAA
TGGGGTCATGATTCGTTTGAGCCGAGTGCGAAAGATGTCGAATCCATGACGGCCAACCAGAAGCTCGTCTTCCTC
GACAGAGTGCAGCAGGCGACGGCCCTGAGCGCGGAACGAGCGCAGCAGCTCGGCAAGGTCTACGACCTAATCACG
ACCAAGAACGCAGAGCTCAAGACGGCCTACTACCTTGTAGCACTCAAGGCGCACGACCCAACATGCGTGTACGGC
GTGGCCGAGCTGCTAGGGGCGGTCGGGCGGATGAAATACGTGCGGCCTCTCTTCCGGGAGCTCAACAAGTTCAAG
AGACAGTTTGCGCTCGATACTTTTGCCAGGAATAAGGACTTTTACCATCCCATCTGCAGGGGCATGGTGGAGAAG
GACCTGGGCATCCATGAGTAG
Transcript >Ophcf2|05440
ATGGCGCACCGCGATCCGTCGACGGCCTCCAACTACGAGGCCTGGCGTACGCGTCACACAACGGTGGAATTCGCC
CTCGACTTCGATGCCAAGCGCCTTCGAGGCTCCGTATTGCTGCAGCTGCAGAGCCAGACGGACCGAGTCAGCAGC
GAGATTGTTCTAGATACCCGCTTCGTCAGCGTGTCGTCGGTCCAGGTCAACGCTTCGCAGGCGGCGTGGGAGCTC
AAGCCTCATGTCGACCCTCTGGGTGCTCCCTTGCACATTGCCGTACCGGGCGGGGCTTCCAAGGGCGACTCGGTT
CATGTCGCTATTTATCTGGAGACGACGGAACGCTGCACGGCTCTGCAGTGGCTGACGCCTGCTCAGACGTCCGGC
CGCAAGTACCCCTACGTCTTTTCGCAGTGCCAGGCCATCAACGCTAGATCCATCTTTCCCTGTCAGGATACGCCC
GACATCAAGTCTACCTACACGTTCAAGTTGACGTCTATTCTTCCCGCTGTTGCTAGCGGAGTCGCCGTCGGCCCC
GATGCCCCCGCTCCTGGGGTCGAGACGGTCTACCAATTTGAGCAGAAAGTCCCCATCCCGTCGTATCTTTTTGCT
CTCGCTTCGGGAGACATCGTCGCCGCGCCTATCGGCTCTCGCAGTCTCGTTGCTACCGGACCCAATGAATTGGCC
GACTGCAAGTGGGAGCTTGAGCGAGACATGGACAAGTTTATGCAAGTTGCCGAGAAGCTCATCTTTCCCTACCGA
TGGGGCCAATATAATGTCCTCGTGCTGCCCCCCAGTTTTCCTTATGGCGGTATGGAAAATCCCATCTACACGTAC
GCCACGCCGACCATTATTAGTGGCGACCGTCAGAACGTCGACGTTATTGCCCATGAGCTTAGCCACAGCTGGAGC
GGCAATCTCGTGACAAATGCCAGCTGGGAGCACTTCTGGCTGAACGAAGGGTGGACCGTTTACCTGGAACGTCGG
ATCCTGGGCGAGATGCACGGAAAAGCACACTTTGACTTTTCGGCAATCATTGGTTGGAAGGGGCTTGAGGACGCC
GTCAAGTTGTTCGGCAAAGATCACGAGTACACCAAGCTGGTGATTCGCCACGACGAGGCCGACCCGGAGGATGTC
TACAGTCAGGTGGCTTACGAGAAGGGCTTCCACTTTCTGTACGAGTTGGATCGGCTGGTTGGGCGCGAGAATTTC
GACAAGTTCATCCCTCACTACTTTACTGAGTGGTCGGAAAAGTCGCTCGACTCGTTCGAGTTTCGCGACACGTTT
GTGCAGTTCTTCAAGGGTCTCGGCGACAAAGAGGTCATTAACAAGGTCGACGCAATCGACTGGGAGGCAAAGTTC
TACACGCCGGGGTTACCGCCGAAGCCGGACTTTGACACGTCGATGGTGAAGGCATGCTATGACTTGGCCGAGAAA
TGGGGTCATGATTCGTTTGAGCCGAGTGCGAAAGATGTCGAATCCATGACGGCCAACCAGAAGCTCGTCTTCCTC
GACAGAGTGCAGCAGGCGACGGCCCTGAGCGCGGAACGAGCGCAGCAGCTCGGCAAGGTCTACGACCTAATCACG
ACCAAGAACGCAGAGCTCAAGACGGCCTACTACCTTGTAGCACTCAAGGCGCACGACCCAACATGCGTGTACGGC
GTGGCCGAGCTGCTAGGGGCGGTCGGGCGGATGAAATACGTGCGGCCTCTCTTCCGGGAGCTCAACAAGTTCAAG
AGACAGTTTGCGCTCGATACTTTTGCCAGGAATAAGGACTTTTACCATCCCATCTGCAGGGGCATGGTGGAGAAG
GACCTGGGCATCCATGAGTAG
Gene >Ophcf2|05440
ATGGCGCACCGCGATCCGTCGACGGCCTCCAACTACGAGGCCTGGCGTACGCGTCACACAACGGTGGAATTCGCC
CTCGACTTCGATGCCAAGCGCCTTCGAGGCTCCGTATTGCTGCAGCTGCAGAGCCAGACGGACCGAGTCAGCAGC
GAGATTGTTCTAGATACCCGCTTCGTCAGCGTGTCGTCGGTCCAGGTCAACGCTTCGCAGGCGGCGTGGGAGCTC
AAGCCTCATGTCGACCCTCTGGGTGCTCCCTTGCACATTGCCGTACCGGGCGGGGCTTCCAAGGGCGACTCGGTT
CATGTCGCTATTTATCTGGAGACGACGGAACGCTGCACGGCTCTGCAGTGGCTGACGCCTGCTCAGACGTCCGGC
CGCAAGTACCCCTACGTCTTTTCGCAGTGCCAGGCCATCAACGCTAGATCCATCTTTCCCTGTCAGGATACGCCC
GACATCAAGTCTACCTACACGTTCAAGTTGACGTCTATTCTTCCCGCTGTTGCTAGCGGAGTCGCCGTCGGCCCC
GATGCCCCCGCTCCTGGGGTCGAGACGGTCTACCAATTTGAGCAGAAAGTCCCCATCCCGTCGTATCTTTTTGCT
CTCGCTTCGGGAGACATCGTCGCCGCGCCTATCGGCTCTCGCAGTCTCGTTGCTACCGGACCCAATGAATTGGCC
GACTGCAAGTGGGAGCTTGAGCGAGACATGGACAAGTTTATGCAAGTTGCCGAGAAGCTCATCTTTCCCTACCGA
TGGGGCCAATATAATGTCCTCGTGCTGCCCCCCAGTTTTCCTTATGGCGGTGAGTGAACCATGGTTTGAGACAGC
CGCAGGGCATAGACGTCTGACGAGGCCTTCAAGGTATGGAAAATCCCATCTACACGTACGCCACGCCGACCATTA
TTAGTGGCGACCGTCAGAACGTCGACGTTATTGCCCATGAGCTTAGCCACAGCTGGAGCGGCAATCTCGTGACAA
ATGCCAGCTGGGAGCACTTGTGAGCAGCCTACCGCGGCGAGGCACGAATATTCCTGGAGCTCACAACGTGTAGCT
GGCTGAACGAAGGGTGGACCGTTTACCTGGAACGTCGGATCCTGGGCGAGATGCACGGAAAAGCACACTTTGACT
TTTCGGCAATCATTGGTTGGAAGGGGCTTGAGGACGCCGTCAAGTTGTTCGGCAAAGATCACGAGTACACCAAGC
TGGTGATTCGCCACGACGAGGCCGACCCGGAGGATGTCTACAGTCAGGTGGCTTACGAGAAGGGCTTCCACTTTC
TGTACGAGTTGGATCGGCTGGTTGGGCGCGAGAATTTCGACAAGTTCATCCCTCACTACTTTACTGAGTGGTCGG
AAAAGTCGCTCGACTCGTTCGAGTTTCGCGACACGTTTGTGCAGTTCTTCAAGGGTCTCGGCGACAAAGAGGTCA
TTAACAAGGTCGACGCAATCGACTGGGAGGCAAAGTTCTACACGCCGGGGTTACCGCCGAAGCCGGACTTTGACA
CGTCGATGGTGAAGGCATGCTATGACTTGGCCGAGAAATGGGGTCATGATGTGAGTTGGCTGGCGGACGTCATCT
GATAATCTATCTGACAGCCAGGGGATAGTCGTTTGAGCCGAGTGCGAAAGATGTCGAATCCATGACGGCCAACCA
GAAGCTCGTCTTCCTCGACAGAGTGCAGCAGGCGACGGCCCTGAGCGCGGAACGAGCGCAGCAGCTCGGCAAGGT
CTACGACCTAATCACGACCAAGAACGCAGAGCTCAAGACGGCCTACTACCTTGTAGCACTCAAGGCGCACGACCC
AACATGCGTGTACGGCGTGGCCGAGCTGCTAGGGGCGGTCGGGCGGATGAAATACGTGCGGCCTCTCTTCCGGGA
GCTCAACAAGTTCAAGAGACAGTTTGCGCTCGATACTTTTGCCAGGAATAAGGACTTTTACCATCCCATCTGCAG
GGGCATGGTGGAGAAGGACCTGGGCATCCATGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail