Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05433
Gene name
Locationscaffold_06:125816..128339
Strand+
Gene length (bp)2523
Transcript length (bp)2190
Coding sequence length (bp)2190
Protein length (aa) 730

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00350 Dynamin_N Dynamin family 4.8E-30 32 253
PF01031 Dynamin_M Dynamin central region 4.8E-26 266 426

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.6224 0.6437 0.1773 0.08 0.1536 0.0098 0.0541 0.0977 0.1344 0.0956

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup55
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|512
Ophiocordyceps australis 1348a (Ghana) OphauG2|372
Ophiocordyceps australis map64 (Brazil) OphauB2|6859
Ophiocordyceps australis map64 (Brazil) OphauB2|2336
Ophiocordyceps australis map64 (Brazil) OphauB2|5353
Ophiocordyceps camponoti-floridani Ophcf2|05433 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01911
Ophiocordyceps camponoti-rufipedis Ophun1|1107
Ophiocordyceps camponoti-rufipedis Ophun1|2181
Ophiocordyceps camponoti-rufipedis Ophun1|3946
Ophiocordyceps kimflemingae Ophio5|1184
Ophiocordyceps kimflemingae Ophio5|1773
Ophiocordyceps subramaniannii Hirsu2|76
Ophiocordyceps subramaniannii Hirsu2|7569
Ophiocordyceps subramaniannii Hirsu2|3659
Ophiocordyceps subramaniannii Hirsu2|3049
Ophiocordyceps subramaniannii Hirsu2|1637
Ophiocordyceps subramaniannii Hirsu2|8420
Ophiocordyceps subramaniannii Hirsu2|10554

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05433
MSDEGLGNASMLAKIDKLRELNVGSLVPLPQLVVVGDQSSGKSSVLESLTGFSFPQDVGLCTRYATQITCARDAV
ESVTISIIPRPDASEGLKTKLLGFHYQLHQLSNSNLGTVFHEANLVMGIRMLSDDDTHEKSGDYDSEVSHDDDHG
DCDVGTGAGAFSQDILKIEIHGPEQSHLTVIDVPGIFRNSTPGLTTETDIILVRNMVQSYMNDRRTIILAVIPCN
VDIATQEILKLAQAADPEGVRTMGVLTKPDLATETATRSAVIDLVQGRRNTLKLGYYVVKNRGADDKTSSLAKRT
EKETAFFMAPPWTRISERCGVTALKDRLRRLLMNISRQEFPQVKSEIEERLRRCKAELDIMGPSRGDQSTQRQYL
GRLATRFQKVSFAALNALYTGEEIFKSDPELRLMTRIIKLNEVFSEVFLKRGHRQLFGDVGEDRDGSVQKNENGP
DVENLPLTKYRELGSIVRTDKFECPLPSEEPIVGCVKEVYHWSRGPELTTFGGTVLSTVFQKQTEKWEKLAVSHA
SDAIVLVHDFIYRLLVHLCPEEAVRNQLWETLLVQELSQRYRKAMDHVRFLLKIECGSRPSTFNHYFTRTLQEKR
SDRLSKPLVAHEETVEDGSSMIPAATIVRIIKDKSQEAQVCDDILDTLTSYYKIARERFVDVICQQVISYSLLEG
DDSPMKVFSPEFVMGLDADQLEMVAGEDEETKEQRLTLERRARSLEEAVKVLRG*
Coding >Ophcf2|05433
ATGTCGGACGAGGGCTTGGGCAATGCCTCTATGCTTGCCAAGATCGATAAACTGCGAGAGCTGAACGTTGGCTCT
CTGGTTCCGTTGCCCCAGCTTGTTGTTGTTGGCGATCAGTCTTCTGGGAAGAGTTCGGTGCTTGAGAGCCTTACG
GGCTTTTCGTTCCCTCAGGACGTCGGACTTTGTACTCGTTACGCTACGCAGATCACTTGCGCGAGAGATGCGGTC
GAGAGCGTGACAATCTCTATAATCCCTCGTCCAGATGCCAGTGAGGGGTTAAAGACCAAGCTGCTCGGCTTCCAT
TACCAACTTCACCAGCTCAGCAACAGTAATCTAGGCACTGTCTTTCATGAGGCAAACCTGGTCATGGGAATTCGT
ATGCTGTCAGATGACGATACCCACGAGAAGTCTGGGGATTATGATTCGGAAGTTTCTCACGATGACGACCATGGA
GATTGTGATGTTGGGACGGGGGCTGGCGCTTTTAGCCAAGACATTCTCAAAATAGAGATACACGGGCCCGAGCAA
AGCCACTTGACTGTCATAGACGTTCCGGGCATCTTCCGCAACTCTACACCTGGCCTCACAACCGAGACGGACATC
ATTCTCGTGAGAAACATGGTGCAGTCCTACATGAATGATCGTCGCACCATTATCCTCGCCGTCATCCCTTGTAAC
GTGGATATCGCCACACAAGAAATCTTGAAGCTCGCCCAAGCAGCAGACCCCGAAGGTGTAAGAACAATGGGCGTC
CTCACAAAGCCAGACTTGGCCACCGAAACGGCAACACGAAGCGCCGTCATCGATCTCGTTCAAGGTCGACGAAAC
ACGCTCAAGCTAGGATACTACGTCGTCAAGAACCGCGGTGCCGACGACAAGACTTCGAGCCTGGCGAAGCGTACG
GAGAAGGAGACGGCTTTCTTCATGGCGCCCCCTTGGACGCGTATCAGTGAGCGATGCGGCGTCACGGCTTTGAAG
GATAGGCTCCGTCGTCTGCTGATGAATATCTCGCGACAGGAGTTTCCGCAAGTCAAGTCGGAGATTGAGGAGCGG
CTTCGACGCTGCAAGGCCGAACTGGATATCATGGGCCCGTCTCGCGGAGATCAGAGCACACAGAGGCAATACCTC
GGAAGACTTGCTACACGCTTCCAAAAGGTGTCGTTTGCCGCCCTCAACGCTCTTTACACGGGCGAGGAAATCTTC
AAGTCAGACCCCGAACTGCGGCTCATGACGCGAATCATAAAGTTGAACGAGGTCTTTTCCGAGGTATTTCTCAAA
CGGGGTCATCGACAGCTCTTTGGCGACGTCGGTGAAGATCGAGACGGCTCCGTGCAGAAGAATGAAAACGGTCCG
GATGTTGAGAACTTGCCCTTGACCAAGTATCGGGAGCTTGGCAGTATCGTGCGGACGGATAAGTTTGAGTGTCCG
TTGCCATCGGAGGAGCCCATCGTGGGATGCGTAAAGGAAGTCTACCACTGGAGTCGAGGACCGGAGCTTACAACC
TTTGGAGGAACAGTCCTCTCAACCGTGTTCCAGAAACAGACGGAGAAGTGGGAGAAGCTCGCAGTATCACACGCC
AGCGACGCCATCGTCCTAGTCCACGACTTCATCTACAGACTGCTAGTCCACCTCTGCCCAGAAGAGGCGGTGAGA
AACCAACTCTGGGAAACGCTCCTAGTGCAAGAGCTCAGCCAGCGATACCGCAAAGCCATGGATCACGTCCGCTTC
CTGCTCAAGATTGAGTGCGGCAGTAGGCCGAGCACCTTTAACCACTACTTCACCCGAACTCTCCAGGAGAAGCGA
AGCGATAGGCTGTCCAAGCCGCTAGTCGCGCACGAGGAGACGGTCGAGGACGGGTCATCGATGATTCCAGCAGCG
ACCATCGTGAGGATCATCAAGGACAAGAGCCAGGAAGCGCAGGTGTGCGATGACATCTTGGACACGCTGACGAGC
TACTACAAGATTGCGCGGGAGCGCTTCGTCGACGTCATCTGCCAGCAGGTAATCAGCTACAGTCTCCTCGAGGGC
GACGATAGCCCGATGAAGGTGTTTAGTCCGGAGTTCGTCATGGGTCTCGATGCCGATCAGCTGGAGATGGTGGCT
GGGGAGGATGAGGAGACCAAGGAGCAGCGGCTCACGTTGGAGAGAAGGGCGCGTAGCCTGGAGGAGGCTGTCAAG
GTGCTCAGGGGGTAG
Transcript >Ophcf2|05433
ATGTCGGACGAGGGCTTGGGCAATGCCTCTATGCTTGCCAAGATCGATAAACTGCGAGAGCTGAACGTTGGCTCT
CTGGTTCCGTTGCCCCAGCTTGTTGTTGTTGGCGATCAGTCTTCTGGGAAGAGTTCGGTGCTTGAGAGCCTTACG
GGCTTTTCGTTCCCTCAGGACGTCGGACTTTGTACTCGTTACGCTACGCAGATCACTTGCGCGAGAGATGCGGTC
GAGAGCGTGACAATCTCTATAATCCCTCGTCCAGATGCCAGTGAGGGGTTAAAGACCAAGCTGCTCGGCTTCCAT
TACCAACTTCACCAGCTCAGCAACAGTAATCTAGGCACTGTCTTTCATGAGGCAAACCTGGTCATGGGAATTCGT
ATGCTGTCAGATGACGATACCCACGAGAAGTCTGGGGATTATGATTCGGAAGTTTCTCACGATGACGACCATGGA
GATTGTGATGTTGGGACGGGGGCTGGCGCTTTTAGCCAAGACATTCTCAAAATAGAGATACACGGGCCCGAGCAA
AGCCACTTGACTGTCATAGACGTTCCGGGCATCTTCCGCAACTCTACACCTGGCCTCACAACCGAGACGGACATC
ATTCTCGTGAGAAACATGGTGCAGTCCTACATGAATGATCGTCGCACCATTATCCTCGCCGTCATCCCTTGTAAC
GTGGATATCGCCACACAAGAAATCTTGAAGCTCGCCCAAGCAGCAGACCCCGAAGGTGTAAGAACAATGGGCGTC
CTCACAAAGCCAGACTTGGCCACCGAAACGGCAACACGAAGCGCCGTCATCGATCTCGTTCAAGGTCGACGAAAC
ACGCTCAAGCTAGGATACTACGTCGTCAAGAACCGCGGTGCCGACGACAAGACTTCGAGCCTGGCGAAGCGTACG
GAGAAGGAGACGGCTTTCTTCATGGCGCCCCCTTGGACGCGTATCAGTGAGCGATGCGGCGTCACGGCTTTGAAG
GATAGGCTCCGTCGTCTGCTGATGAATATCTCGCGACAGGAGTTTCCGCAAGTCAAGTCGGAGATTGAGGAGCGG
CTTCGACGCTGCAAGGCCGAACTGGATATCATGGGCCCGTCTCGCGGAGATCAGAGCACACAGAGGCAATACCTC
GGAAGACTTGCTACACGCTTCCAAAAGGTGTCGTTTGCCGCCCTCAACGCTCTTTACACGGGCGAGGAAATCTTC
AAGTCAGACCCCGAACTGCGGCTCATGACGCGAATCATAAAGTTGAACGAGGTCTTTTCCGAGGTATTTCTCAAA
CGGGGTCATCGACAGCTCTTTGGCGACGTCGGTGAAGATCGAGACGGCTCCGTGCAGAAGAATGAAAACGGTCCG
GATGTTGAGAACTTGCCCTTGACCAAGTATCGGGAGCTTGGCAGTATCGTGCGGACGGATAAGTTTGAGTGTCCG
TTGCCATCGGAGGAGCCCATCGTGGGATGCGTAAAGGAAGTCTACCACTGGAGTCGAGGACCGGAGCTTACAACC
TTTGGAGGAACAGTCCTCTCAACCGTGTTCCAGAAACAGACGGAGAAGTGGGAGAAGCTCGCAGTATCACACGCC
AGCGACGCCATCGTCCTAGTCCACGACTTCATCTACAGACTGCTAGTCCACCTCTGCCCAGAAGAGGCGGTGAGA
AACCAACTCTGGGAAACGCTCCTAGTGCAAGAGCTCAGCCAGCGATACCGCAAAGCCATGGATCACGTCCGCTTC
CTGCTCAAGATTGAGTGCGGCAGTAGGCCGAGCACCTTTAACCACTACTTCACCCGAACTCTCCAGGAGAAGCGA
AGCGATAGGCTGTCCAAGCCGCTAGTCGCGCACGAGGAGACGGTCGAGGACGGGTCATCGATGATTCCAGCAGCG
ACCATCGTGAGGATCATCAAGGACAAGAGCCAGGAAGCGCAGGTGTGCGATGACATCTTGGACACGCTGACGAGC
TACTACAAGATTGCGCGGGAGCGCTTCGTCGACGTCATCTGCCAGCAGGTAATCAGCTACAGTCTCCTCGAGGGC
GACGATAGCCCGATGAAGGTGTTTAGTCCGGAGTTCGTCATGGGTCTCGATGCCGATCAGCTGGAGATGGTGGCT
GGGGAGGATGAGGAGACCAAGGAGCAGCGGCTCACGTTGGAGAGAAGGGCGCGTAGCCTGGAGGAGGCTGTCAAG
GTGCTCAGGGGGTAG
Gene >Ophcf2|05433
ATGTCGGACGAGGGCTTGGGCAATGCCTCTATGCTTGCCAAGATCGATAAACTGCGAGAGCTGAACGTTGGCTCT
CTGGTTCCGTTGCCCCAGGTATGCTTGGTTGGTTGAAGATGCGGGGGAGGTTTCTGACGAGACGTAGCTTGTTGT
TGTTGGCGATCAGTCTTCTGGGAAGAGTTCGGTGCTTGAGAGCCTTACGGGCTTTTCGTTCCCTCAGGACGTCGG
ACTTTGTACTCGTTACGCTACGCAGATCACTTGCGCGAGAGATGCGGTCGAGAGCGTGACAATCTCTATAATCCC
TCGTCCAGATGCCAGTGAGGGGTTAAAGACCAAGCTGCTCGGCTTCCATTACCAACTTCACCAGCTCAGCAACAG
TAATCTAGGCACTGTCTTTCATGAGGTCTGTCCTCCGGTTCGGAGATTTGGGTGCTCTACCACTGACGGCATTTC
AGGCAAACCTGGTCATGGGAATTCGTATGCTGTCAGATGACGATACCCACGAGAAGTCTGGGGATTATGATTCGG
AAGTTTCTCACGATGACGACCATGGAGATTGTGATGTTGGGACGGGGGCTGGCGCTTTTAGCCAAGACATTCTCA
AAATAGAGATACACGGGCCCGAGGTAGGTGACTATACCTGACGCTCGACGTTCTGCCACCTGTACTAACCAGAGC
GCTGCAAAATTAGCAAAGCCACTTGACTGTCATAGACGTTCCGGGCATCTTCCGCAACTCTACACCTGGTAGGCT
GTACGGCCACCCTGTTTGGCTTGCGAAAACGGGCTTAACCTATGTTCCAAGGCCTCACAACCGAGACGGACATCA
TTCTCGTGAGAAACATGGTGCAGTCCTACATGAATGATCGTCGCACCATGTTAGCTTCCCAAAGTCCGCATCTGG
ACCTGAAGGATGCTAATGCTTCGAAAGTATCCTCGCCGTCATCCCTTGTAACGTGGATATCGCCACACAAGAAAT
CTTGAAGCTCGCCCAAGCAGCAGACCCCGAAGGTGTAAGAACAATGGGCGTCCTCACAAAGCCAGACTTGGCCAC
CGAAACGGCAACACGAAGCGCCGTCATCGATCTCGTTCAAGGTCGACGAAACACGCTCAAGCTAGGATACTACGT
CGTCAAGAACCGCGGTGCCGACGACAAGACTTCGAGCCTGGCGAAGCGTACGGAGAAGGAGACGGCTTTCTTCAT
GGCGCCCCCTTGGACGCGTATCAGTGAGCGATGCGGCGTCACGGCTTTGAAGGATAGGCTCCGTCGTCTGCTGAT
GAATATCTCGCGACAGGAGTTTCCGCAAGTCAAGTCGGAGATTGAGGAGCGGCTTCGACGCTGCAAGGCCGAACT
GGATATCATGGGCCCGTCTCGCGGAGATCAGAGCACACAGAGGCAATACCTCGGAAGACTTGCTACACGCTTCCA
AAAGGTGTCGTTTGCCGCCCTCAACGCTCTTTACACGGGCGAGGAAATCTTCAAGTCAGACCCCGAACTGCGGCT
CATGACGCGAATCATAAAGTTGAACGAGGTCTTTTCCGAGGTATTTCTCAAACGGGGTCATCGACAGCTCTTTGG
CGACGTCGGTGAAGATCGAGACGGCTCCGTGCAGAAGAATGAAAACGGTCCGGATGTTGAGAACTTGCCCTTGAC
CAAGTATCGGGAGCTTGGCAGTATCGTGCGGACGGATAAGTTTGAGTGTCCGTTGCCATCGGAGGAGCCCATCGT
GGGATGCGTAAAGGAAGTCTACCACTGGAGTCGAGGACCGGAGCTTACAACCGTGAGTTGTTTCCAAACATCCTT
TTTCACACCTTTGATTGCGCTCATCTGTTGTAGTTTGGAGGAACAGTCCTCTCAACCGTGTTCCAGAAACAGACG
GAGAAGTGGGAGAAGCTCGCAGTATCACACGCCAGCGACGCCATCGTCCTAGTCCACGACTTCATCTACAGACTG
CTAGTCCACCTCTGCCCAGAAGAGGCGGTGAGAAACCAACTCTGGGAAACGCTCCTAGTGCAAGAGCTCAGCCAG
CGATACCGCAAAGCCATGGATCACGTCCGCTTCCTGCTCAAGATTGAGTGCGGCAGTAGGCCGAGCACCTTTAAC
CACTACTTCACCCGAACTCTCCAGGAGAAGCGAAGCGATAGGCTGTCCAAGCCGCTAGTCGCGCACGAGGAGACG
GTCGAGGACGGGTCATCGATGATTCCAGCAGCGACCATCGTGAGGATCATCAAGGACAAGAGCCAGGAAGCGCAG
GTGTGCGATGACATCTTGGACACGCTGACGAGCTACTACAAGATTGCGCGGGAGCGCTTCGTCGACGTCATCTGC
CAGCAGGTAATCAGCTACAGTCTCCTCGAGGGCGACGATAGCCCGATGAAGGTGTTTAGTCCGGAGTTCGTCATG
GGTCTCGATGCCGATCAGCTGGAGATGGTGGCTGGGGAGGATGAGGAGACCAAGGAGCAGCGGCTCACGTTGGAG
AGAAGGGCGCGTAGCCTGGAGGAGGCTGTCAAGGTGCTCAGGGGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail