Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05424
Gene name
Locationscaffold_06:98573..99118
Strand-
Gene length (bp)545
Transcript length (bp)480
Coding sequence length (bp)480
Protein length (aa) 160

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10224 DUF2205 Short coiled-coil protein 1.4E-37 82 155

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5501 0.5497 0.079 0.2037 0.1404 0.0022 0.0952 0.2782 0.2087 0.1063

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4903
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6371
Ophiocordyceps australis map64 (Brazil) OphauB2|5879
Ophiocordyceps camponoti-floridani Ophcf2|05424 (this protein)
Ophiocordyceps kimflemingae Ophio5|1172
Ophiocordyceps subramaniannii Hirsu2|1367

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05424
MSDQHEGPSGGSNANASSTMERSDSSTSSTPSDSHEPVLHHPTPTRPPLPSRKSSGPLAVPRDSSAVGPVDAHFG
PDDVRAMSPRRTSEDIDKLGREARAELHRHAKALQESLLTIFNRIEAVREEHDKLDNNNRFLQKYIGDLMSTSNI
TASTSRTKK*
Coding >Ophcf2|05424
ATGTCGGATCAACACGAAGGCCCGTCGGGCGGCTCCAACGCCAACGCGAGCAGCACCATGGAGCGATCAGATTCG
TCGACTTCTTCTACGCCCTCCGATTCTCACGAGCCCGTTCTGCATCATCCCACCCCGACGCGTCCACCCCTGCCC
AGCCGCAAGAGCAGTGGTCCCTTGGCCGTCCCACGCGATAGCTCCGCCGTCGGACCCGTTGATGCCCACTTCGGA
CCCGATGATGTCCGCGCCATGAGCCCAAGACGCACCAGCGAGGACATTGATAAGCTGGGAAGGGAGGCTAGAGCC
GAGCTGCATAGGCATGCAAAGGCCCTGCAAGAGTCGCTCCTCACAATCTTCAACCGCATCGAGGCCGTCCGCGAG
GAGCACGACAAACTCGACAACAACAACCGGTTCTTGCAAAAATATATCGGCGATCTCATGAGCACCAGCAACATT
ACCGCCTCGACCAGCCGCACCAAGAAGTGA
Transcript >Ophcf2|05424
ATGTCGGATCAACACGAAGGCCCGTCGGGCGGCTCCAACGCCAACGCGAGCAGCACCATGGAGCGATCAGATTCG
TCGACTTCTTCTACGCCCTCCGATTCTCACGAGCCCGTTCTGCATCATCCCACCCCGACGCGTCCACCCCTGCCC
AGCCGCAAGAGCAGTGGTCCCTTGGCCGTCCCACGCGATAGCTCCGCCGTCGGACCCGTTGATGCCCACTTCGGA
CCCGATGATGTCCGCGCCATGAGCCCAAGACGCACCAGCGAGGACATTGATAAGCTGGGAAGGGAGGCTAGAGCC
GAGCTGCATAGGCATGCAAAGGCCCTGCAAGAGTCGCTCCTCACAATCTTCAACCGCATCGAGGCCGTCCGCGAG
GAGCACGACAAACTCGACAACAACAACCGGTTCTTGCAAAAATATATCGGCGATCTCATGAGCACCAGCAACATT
ACCGCCTCGACCAGCCGCACCAAGAAGTGA
Gene >Ophcf2|05424
ATGTCGGATCAACACGAAGGCCCGTCGGGCGGCTCCAACGCCAACGCGAGCAGCACCATGGAGCGATCAGATTCG
TCGACTTCTTCTACGCCCTCCGATTCTCACGAGCCCGTTCTGCATCATCCCACCCCGACGCGTCCACCCCTGCCC
AGCCGCAAGAGCAGTGGTCCCTTGGCCGTCCCACGCGATAGCTCCGCCGTCGGACCCGTTGATGCCCACTTCGGA
CCCGATGATGTCCGCGCCATGAGCCCAAGACGCACCAGCGAGGACATTGATAAGCTGGGAAGGGAGGCTAGAGCC
GAGCTGCATAGGTACGAATATGGTCTCCGTCTCCATGCTTTCTCTTCCCCTTCCGGCCCGTTGACGCCACAGGCA
GGCATGCAAAGGCCCTGCAAGAGTCGCTCCTCACAATCTTCAACCGCATCGAGGCCGTCCGCGAGGAGCACGACA
AACTCGACAACAACAACCGGTTCTTGCAAAAATATATCGGCGATCTCATGAGCACCAGCAACATTACCGCCTCGA
CCAGCCGCACCAAGAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail