Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05421
Gene name
Locationscaffold_06:89316..90498
Strand+
Gene length (bp)1182
Transcript length (bp)1182
Coding sequence length (bp)1182
Protein length (aa) 394

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01008 IF-2B Initiation factor 2 subunit family 1.1E-72 46 370

GO

GO Term Description Terminal node
GO:0044237 cellular metabolic process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0009987 cellular process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7839 0.527 0.0246 0.0531 0.2865 0.1949 0.0827 0.1298 0.0289 0.0059

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1654
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5778
Ophiocordyceps australis map64 (Brazil) OphauB2|5876
Ophiocordyceps camponoti-floridani Ophcf2|05421 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1538
Ophiocordyceps kimflemingae Ophio5|1788
Ophiocordyceps subramaniannii Hirsu2|1363

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05421
MSALEAVRYSRGKLQVLDQLRLPHEFHYDDVATRAEAFDCIASMRVRGAPAIAIVAGLGLAVELFNESANESPSA
SAAEAEARILEGLDYLATSRPTAVDLSNAVTVLGDAVRAEAAKPNADGPAVVTAYIKEAEALLARDRRTNLAIAD
AGADWLCARAGASASAPISVLTHCNSGSFATSGHGTALGIVRTLYSRGLLRHVFCTETRPYNQGSRLTAFELVYE
KIPGTLITDSMAASLFRTRGAEVNMAAVIVGADRVVRNGDTANKIGTYQLAVLARHHGIPFIVAAPTTSIDLKTE
TGDDIRIEERKPQELTQLTGAQVRPDGSVDKNTNVRVATADQTISVWNPAFDVTPAELIDVIVTEKGVVEKGADG
AFDFRKLMPERWAKLVVT*
Coding >Ophcf2|05421
ATGTCCGCGCTCGAGGCCGTGCGCTACTCGCGCGGCAAACTTCAAGTCCTCGATCAGCTCCGCCTCCCGCACGAA
TTCCATTACGATGACGTGGCCACTCGCGCTGAAGCATTCGATTGCATCGCCTCAATGCGCGTTCGCGGCGCTCCG
GCCATCGCCATCGTCGCGGGCCTCGGCCTCGCCGTCGAGCTTTTCAATGAGTCCGCGAATGAGTCCCCATCCGCT
TCCGCTGCAGAGGCAGAGGCACGGATTCTTGAGGGACTCGATTACCTCGCTACAAGCCGTCCTACTGCTGTCGAC
CTCTCCAACGCTGTTACCGTGTTGGGAGATGCTGTCCGCGCCGAGGCTGCGAAACCGAATGCCGACGGGCCTGCC
GTGGTGACGGCTTATATCAAAGAGGCTGAGGCTTTGCTGGCCCGCGACCGGAGAACCAACTTGGCCATCGCCGAT
GCCGGTGCCGACTGGCTTTGTGCCCGCGCTGGCGCCTCGGCCTCTGCCCCCATCTCGGTCTTGACGCATTGCAAC
TCGGGCTCGTTCGCCACTTCTGGCCACGGCACTGCTCTCGGAATCGTTCGCACGCTATATTCTCGTGGACTGCTG
CGTCACGTGTTCTGCACCGAGACGCGGCCTTACAATCAGGGAAGTCGCCTGACGGCCTTTGAGCTCGTCTACGAA
AAGATCCCGGGCACCCTCATTACCGACTCCATGGCCGCCTCGCTCTTTCGCACCCGTGGTGCTGAGGTCAACATG
GCCGCCGTCATCGTCGGCGCCGATCGCGTCGTCCGCAACGGAGACACAGCCAACAAAATCGGAACGTACCAGCTA
GCCGTTCTGGCTCGCCACCACGGCATCCCCTTTATTGTCGCCGCGCCGACGACGAGCATCGATCTTAAGACGGAG
ACGGGCGATGACATCCGAATCGAAGAGCGCAAGCCCCAAGAGCTCACGCAATTGACCGGCGCACAGGTCCGACCG
GACGGCTCCGTCGATAAGAACACCAATGTGCGCGTCGCCACGGCAGACCAGACCATCAGCGTGTGGAATCCGGCC
TTTGACGTGACACCCGCTGAACTCATCGACGTCATCGTGACTGAAAAGGGTGTCGTCGAAAAGGGGGCGGATGGT
GCCTTTGACTTTCGCAAACTCATGCCCGAGAGATGGGCCAAGTTGGTAGTGACGTAA
Transcript >Ophcf2|05421
ATGTCCGCGCTCGAGGCCGTGCGCTACTCGCGCGGCAAACTTCAAGTCCTCGATCAGCTCCGCCTCCCGCACGAA
TTCCATTACGATGACGTGGCCACTCGCGCTGAAGCATTCGATTGCATCGCCTCAATGCGCGTTCGCGGCGCTCCG
GCCATCGCCATCGTCGCGGGCCTCGGCCTCGCCGTCGAGCTTTTCAATGAGTCCGCGAATGAGTCCCCATCCGCT
TCCGCTGCAGAGGCAGAGGCACGGATTCTTGAGGGACTCGATTACCTCGCTACAAGCCGTCCTACTGCTGTCGAC
CTCTCCAACGCTGTTACCGTGTTGGGAGATGCTGTCCGCGCCGAGGCTGCGAAACCGAATGCCGACGGGCCTGCC
GTGGTGACGGCTTATATCAAAGAGGCTGAGGCTTTGCTGGCCCGCGACCGGAGAACCAACTTGGCCATCGCCGAT
GCCGGTGCCGACTGGCTTTGTGCCCGCGCTGGCGCCTCGGCCTCTGCCCCCATCTCGGTCTTGACGCATTGCAAC
TCGGGCTCGTTCGCCACTTCTGGCCACGGCACTGCTCTCGGAATCGTTCGCACGCTATATTCTCGTGGACTGCTG
CGTCACGTGTTCTGCACCGAGACGCGGCCTTACAATCAGGGAAGTCGCCTGACGGCCTTTGAGCTCGTCTACGAA
AAGATCCCGGGCACCCTCATTACCGACTCCATGGCCGCCTCGCTCTTTCGCACCCGTGGTGCTGAGGTCAACATG
GCCGCCGTCATCGTCGGCGCCGATCGCGTCGTCCGCAACGGAGACACAGCCAACAAAATCGGAACGTACCAGCTA
GCCGTTCTGGCTCGCCACCACGGCATCCCCTTTATTGTCGCCGCGCCGACGACGAGCATCGATCTTAAGACGGAG
ACGGGCGATGACATCCGAATCGAAGAGCGCAAGCCCCAAGAGCTCACGCAATTGACCGGCGCACAGGTCCGACCG
GACGGCTCCGTCGATAAGAACACCAATGTGCGCGTCGCCACGGCAGACCAGACCATCAGCGTGTGGAATCCGGCC
TTTGACGTGACACCCGCTGAACTCATCGACGTCATCGTGACTGAAAAGGGTGTCGTCGAAAAGGGGGCGGATGGT
GCCTTTGACTTTCGCAAACTCATGCCCGAGAGATGGGCCAAGTTGGTAGTGACGTAA
Gene >Ophcf2|05421
ATGTCCGCGCTCGAGGCCGTGCGCTACTCGCGCGGCAAACTTCAAGTCCTCGATCAGCTCCGCCTCCCGCACGAA
TTCCATTACGATGACGTGGCCACTCGCGCTGAAGCATTCGATTGCATCGCCTCAATGCGCGTTCGCGGCGCTCCG
GCCATCGCCATCGTCGCGGGCCTCGGCCTCGCCGTCGAGCTTTTCAATGAGTCCGCGAATGAGTCCCCATCCGCT
TCCGCTGCAGAGGCAGAGGCACGGATTCTTGAGGGACTCGATTACCTCGCTACAAGCCGTCCTACTGCTGTCGAC
CTCTCCAACGCTGTTACCGTGTTGGGAGATGCTGTCCGCGCCGAGGCTGCGAAACCGAATGCCGACGGGCCTGCC
GTGGTGACGGCTTATATCAAAGAGGCTGAGGCTTTGCTGGCCCGCGACCGGAGAACCAACTTGGCCATCGCCGAT
GCCGGTGCCGACTGGCTTTGTGCCCGCGCTGGCGCCTCGGCCTCTGCCCCCATCTCGGTCTTGACGCATTGCAAC
TCGGGCTCGTTCGCCACTTCTGGCCACGGCACTGCTCTCGGAATCGTTCGCACGCTATATTCTCGTGGACTGCTG
CGTCACGTGTTCTGCACCGAGACGCGGCCTTACAATCAGGGAAGTCGCCTGACGGCCTTTGAGCTCGTCTACGAA
AAGATCCCGGGCACCCTCATTACCGACTCCATGGCCGCCTCGCTCTTTCGCACCCGTGGTGCTGAGGTCAACATG
GCCGCCGTCATCGTCGGCGCCGATCGCGTCGTCCGCAACGGAGACACAGCCAACAAAATCGGAACGTACCAGCTA
GCCGTTCTGGCTCGCCACCACGGCATCCCCTTTATTGTCGCCGCGCCGACGACGAGCATCGATCTTAAGACGGAG
ACGGGCGATGACATCCGAATCGAAGAGCGCAAGCCCCAAGAGCTCACGCAATTGACCGGCGCACAGGTCCGACCG
GACGGCTCCGTCGATAAGAACACCAATGTGCGCGTCGCCACGGCAGACCAGACCATCAGCGTGTGGAATCCGGCC
TTTGACGTGACACCCGCTGAACTCATCGACGTCATCGTGACTGAAAAGGGTGTCGTCGAAAAGGGGGCGGATGGT
GCCTTTGACTTTCGCAAACTCATGCCCGAGAGATGGGCCAAGTTGGTAGTGACGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail