Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05405
Gene name
Locationscaffold_06:39413..41600
Strand-
Gene length (bp)2187
Transcript length (bp)2130
Coding sequence length (bp)2130
Protein length (aa) 710

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00566 RabGAP-TBC Rab-GTPase-TBC domain 2.3E-31 444 665

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6889 0.3117 0.0553 0.1569 0.0597 0.0014 0.0751 0.3982 0.4123 0.0203

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3866
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2610
Ophiocordyceps australis map64 (Brazil) OphauB2|6816
Ophiocordyceps camponoti-floridani Ophcf2|05405 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5997
Ophiocordyceps kimflemingae Ophio5|1578
Ophiocordyceps subramaniannii Hirsu2|7655

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05405
MIREQVIALPSRDSLPGMTTSKSSKSSSFHSLTSHDGSLLGDVGHFEEIGLDDDGATLKSPACLPVSPVNVPPPT
PQPHTRNLASAKRCPTPRRSFPNLHANLHSSNPRSTNLAVITDPRVLALPRGSSPSSLIRRNRSTSPVPSPSSRD
PGRPRTPRRGSWQANRDRRTLTELEDECDDNDGDDIPDHIVLDNVPISPRPANERVPSRSPSMSPPLERAPNKDR
VRSVGNGTPPVAQDHGSLRSPSWRSDSTDRSPMSASKLRTTNWNAALADLSAEAKALTEKLEEHADEQEEHYFKQ
PPNSVRPNTWNPSHTTTAHMYDKKERVKSSTPELPPVRRTNIMIDPLPISKEKEAVLSRTRPSWLPPKDPNEEKR
HLREYQQMMAASVKADERREAARRSKTESRDSNADHLMHVWEDDIVPRWNQAIRERRTRDMWWRGIAPRSRGLVW
TRAIGNQLGLTAASFQTALSRAGDVETRLRTDRGDAEDARRAKWFDRIRRDAGDGTWTELRIFQPGGPLNSALVD
VLSAYAMYRNDVGYVSGSNAIAALLLLNLPDTETTFIALANLLNRPLPLSFHTSDQGAQASAFNLVLQTLSNQSP
ALHDHLTRTVANLEPEEYLGHMFTTLFADHLSIDEAARLWDVYVFEGDAVLVRAAVAVLLRHEMALLGSKTAGEI
RAVMSRLHGPSGHAVAPVGAEDHFMRLVREAGKA*
Coding >Ophcf2|05405
ATGATCCGCGAACAGGTCATCGCCTTGCCCTCGCGCGACTCGCTGCCGGGCATGACCACGTCCAAGAGCTCCAAG
TCGTCGTCCTTTCACTCCCTCACCAGCCACGACGGCAGCCTCCTGGGCGACGTCGGTCACTTCGAAGAAATTGGC
CTCGACGACGATGGTGCCACGCTCAAGAGCCCGGCCTGTCTGCCCGTCTCGCCCGTCAATGTTCCGCCGCCGACG
CCTCAACCGCATACGCGCAATCTCGCGTCGGCCAAGCGCTGTCCGACTCCTCGACGCTCCTTTCCCAACCTACAC
GCGAATCTTCACTCGTCGAACCCGAGAAGTACCAATCTCGCCGTCATCACCGATCCGCGCGTTCTCGCCCTTCCC
AGAGGGTCGTCTCCTTCTTCATTGATACGCCGAAATCGAAGCACTAGTCCCGTGCCGTCGCCCAGTTCCCGCGAC
CCCGGCCGCCCTCGCACTCCTCGACGCGGCAGCTGGCAGGCTAACCGCGACCGAAGGACGCTTACCGAGCTGGAG
GACGAGTGTGACGATAACGATGGCGACGATATACCCGATCACATCGTCCTCGATAACGTGCCCATCTCACCGCGT
CCAGCCAACGAGCGTGTCCCAAGCCGCTCCCCGAGCATGAGCCCGCCGCTCGAGCGTGCCCCCAACAAGGATCGT
GTGCGGAGTGTGGGCAACGGCACGCCACCCGTCGCCCAAGATCATGGCTCACTGCGCTCTCCCTCGTGGCGATCC
GACTCGACCGACCGCTCCCCAATGAGCGCATCTAAGCTGAGGACCACCAACTGGAACGCAGCTCTGGCCGATCTG
AGCGCCGAGGCCAAGGCTCTGACGGAGAAACTCGAGGAGCACGCTGACGAGCAGGAAGAGCATTACTTCAAACAG
CCCCCCAACTCTGTCAGGCCAAACACGTGGAACCCGAGCCACACGACGACGGCGCACATGTACGACAAGAAGGAG
CGTGTCAAGTCGTCGACGCCCGAGCTGCCGCCCGTCCGGAGGACCAATATCATGATCGACCCGCTCCCCATATCC
AAGGAAAAGGAGGCCGTCCTGAGCCGCACTCGGCCTTCGTGGCTGCCACCCAAGGACCCCAATGAGGAGAAGCGC
CATCTGCGCGAGTACCAACAAATGATGGCGGCCAGCGTCAAGGCCGACGAGCGTCGCGAAGCCGCACGACGGTCC
AAGACGGAATCGAGAGACAGCAACGCCGATCACCTGATGCACGTGTGGGAGGACGACATCGTTCCCCGCTGGAAT
CAGGCCATCCGCGAGCGTCGGACGCGCGACATGTGGTGGAGAGGCATCGCCCCGCGGAGCCGCGGCCTCGTCTGG
ACGCGAGCCATTGGCAATCAGCTGGGCTTAACAGCGGCATCGTTTCAAACGGCCTTGTCTCGCGCGGGCGACGTC
GAGACACGCCTGAGAACGGACCGGGGAGACGCCGAGGACGCGAGAAGGGCAAAGTGGTTCGACCGCATTCGCAGG
GACGCGGGCGACGGAACCTGGACGGAGCTGCGCATCTTCCAACCCGGCGGGCCTCTGAACAGTGCCCTCGTTGAT
GTGCTGAGCGCGTACGCCATGTACAGGAACGACGTCGGCTACGTCTCTGGCAGCAATGCCATCGCCGCGCTGCTC
CTACTCAACCTCCCCGACACGGAGACGACCTTCATCGCGCTCGCCAACCTGCTTAACCGGCCACTGCCCCTCTCG
TTCCACACGTCAGACCAAGGCGCTCAAGCCTCAGCCTTTAACCTGGTGCTGCAGACGCTCAGCAACCAGTCGCCC
GCCTTGCACGACCACCTGACGCGCACGGTGGCAAACTTGGAGCCGGAGGAGTATCTCGGCCACATGTTCACCACC
CTGTTCGCCGACCACCTTTCCATCGACGAGGCGGCTAGGCTGTGGGACGTCTACGTGTTCGAGGGCGACGCGGTG
CTTGTGCGTGCCGCTGTTGCGGTTTTGCTACGACATGAAATGGCCCTGCTGGGCAGCAAGACGGCTGGTGAGATT
CGAGCGGTCATGAGCAGATTGCACGGGCCATCTGGGCACGCTGTGGCGCCCGTCGGAGCTGAGGACCATTTCATG
CGGTTGGTCCGCGAAGCTGGCAAGGCCTGA
Transcript >Ophcf2|05405
ATGATCCGCGAACAGGTCATCGCCTTGCCCTCGCGCGACTCGCTGCCGGGCATGACCACGTCCAAGAGCTCCAAG
TCGTCGTCCTTTCACTCCCTCACCAGCCACGACGGCAGCCTCCTGGGCGACGTCGGTCACTTCGAAGAAATTGGC
CTCGACGACGATGGTGCCACGCTCAAGAGCCCGGCCTGTCTGCCCGTCTCGCCCGTCAATGTTCCGCCGCCGACG
CCTCAACCGCATACGCGCAATCTCGCGTCGGCCAAGCGCTGTCCGACTCCTCGACGCTCCTTTCCCAACCTACAC
GCGAATCTTCACTCGTCGAACCCGAGAAGTACCAATCTCGCCGTCATCACCGATCCGCGCGTTCTCGCCCTTCCC
AGAGGGTCGTCTCCTTCTTCATTGATACGCCGAAATCGAAGCACTAGTCCCGTGCCGTCGCCCAGTTCCCGCGAC
CCCGGCCGCCCTCGCACTCCTCGACGCGGCAGCTGGCAGGCTAACCGCGACCGAAGGACGCTTACCGAGCTGGAG
GACGAGTGTGACGATAACGATGGCGACGATATACCCGATCACATCGTCCTCGATAACGTGCCCATCTCACCGCGT
CCAGCCAACGAGCGTGTCCCAAGCCGCTCCCCGAGCATGAGCCCGCCGCTCGAGCGTGCCCCCAACAAGGATCGT
GTGCGGAGTGTGGGCAACGGCACGCCACCCGTCGCCCAAGATCATGGCTCACTGCGCTCTCCCTCGTGGCGATCC
GACTCGACCGACCGCTCCCCAATGAGCGCATCTAAGCTGAGGACCACCAACTGGAACGCAGCTCTGGCCGATCTG
AGCGCCGAGGCCAAGGCTCTGACGGAGAAACTCGAGGAGCACGCTGACGAGCAGGAAGAGCATTACTTCAAACAG
CCCCCCAACTCTGTCAGGCCAAACACGTGGAACCCGAGCCACACGACGACGGCGCACATGTACGACAAGAAGGAG
CGTGTCAAGTCGTCGACGCCCGAGCTGCCGCCCGTCCGGAGGACCAATATCATGATCGACCCGCTCCCCATATCC
AAGGAAAAGGAGGCCGTCCTGAGCCGCACTCGGCCTTCGTGGCTGCCACCCAAGGACCCCAATGAGGAGAAGCGC
CATCTGCGCGAGTACCAACAAATGATGGCGGCCAGCGTCAAGGCCGACGAGCGTCGCGAAGCCGCACGACGGTCC
AAGACGGAATCGAGAGACAGCAACGCCGATCACCTGATGCACGTGTGGGAGGACGACATCGTTCCCCGCTGGAAT
CAGGCCATCCGCGAGCGTCGGACGCGCGACATGTGGTGGAGAGGCATCGCCCCGCGGAGCCGCGGCCTCGTCTGG
ACGCGAGCCATTGGCAATCAGCTGGGCTTAACAGCGGCATCGTTTCAAACGGCCTTGTCTCGCGCGGGCGACGTC
GAGACACGCCTGAGAACGGACCGGGGAGACGCCGAGGACGCGAGAAGGGCAAAGTGGTTCGACCGCATTCGCAGG
GACGCGGGCGACGGAACCTGGACGGAGCTGCGCATCTTCCAACCCGGCGGGCCTCTGAACAGTGCCCTCGTTGAT
GTGCTGAGCGCGTACGCCATGTACAGGAACGACGTCGGCTACGTCTCTGGCAGCAATGCCATCGCCGCGCTGCTC
CTACTCAACCTCCCCGACACGGAGACGACCTTCATCGCGCTCGCCAACCTGCTTAACCGGCCACTGCCCCTCTCG
TTCCACACGTCAGACCAAGGCGCTCAAGCCTCAGCCTTTAACCTGGTGCTGCAGACGCTCAGCAACCAGTCGCCC
GCCTTGCACGACCACCTGACGCGCACGGTGGCAAACTTGGAGCCGGAGGAGTATCTCGGCCACATGTTCACCACC
CTGTTCGCCGACCACCTTTCCATCGACGAGGCGGCTAGGCTGTGGGACGTCTACGTGTTCGAGGGCGACGCGGTG
CTTGTGCGTGCCGCTGTTGCGGTTTTGCTACGACATGAAATGGCCCTGCTGGGCAGCAAGACGGCTGGTGAGATT
CGAGCGGTCATGAGCAGATTGCACGGGCCATCTGGGCACGCTGTGGCGCCCGTCGGAGCTGAGGACCATTTCATG
CGGTTGGTCCGCGAAGCTGGCAAGGCCTGA
Gene >Ophcf2|05405
ATGATCCGCGAACAGGTCATCGCCTTGCCCTCGCGCGACTCGCTGCCGGGCATGACCACGTCCAAGAGCTCCAAG
TCGTCGTCCTTTCACTCCCTCACCAGCCACGACGGCAGCCTCCTGGGCGACGTCGGTCACTTCGAAGAAATTGGC
CTCGACGACGATGGTGCCACGCTCAAGAGCCCGGCCTGTCTGCCCGTCTCGCCCGTCAATGTTCCGCCGCCGACG
CCTCAACCGCATACGCGCAATCTCGCGTCGGCCAAGCGCTGTCCGACTCCTCGACGCTCCTTTCCCAACCTACAC
GCGAATCTTCACTCGTCGAACCCGAGAAGTACCAATCTCGCCGTCATCACCGATCCGCGCGTTCTCGCCCTTCCC
AGAGGGTCGTCTCCTTCTTCATTGATACGCCGAAATCGAAGCACTAGTCCCGTGCCGTCGCCCAGTTCCCGCGAC
CCCGGCCGCCCTCGCACTCCTCGACGCGGCAGCTGGCAGGCTAACCGCGACCGAAGGACGCTTACCGAGCTGGAG
GACGAGTGTGACGATAACGATGGCGACGATATACCCGATCACATCGTCCTCGATAACGTGCCCATCTCACCGCGT
CCAGCCAACGAGCGTGTCCCAAGCCGCTCCCCGAGCATGAGCCCGCCGCTCGAGCGTGCCCCCAACAAGGATCGT
GTGCGGAGTGTGGGCAACGGCACGCCACCCGTCGCCCAAGATCATGGCTCACTGCGCTCTCCCTCGTGGCGATCC
GACTCGACCGACCGCTCCCCAATGAGCGCATCTAAGCTGAGGACCACCAACTGGAACGCAGCTCTGGCCGATCTG
AGCGCCGAGGCCAAGGCTCTGACGGAGAAACTCGAGGAGCACGCTGACGAGCAGGAAGAGCATTACTTCAAACAG
CCCCCCAACTCTGTCAGGCCAAACACGTGGAACCCGAGCCACACGACGACGGCGCACATGTACGACAAGAAGGAG
CGTGTCAAGTCGTCGACGCCCGAGCTGCCGCCCGTCCGGAGGACCAATATCATGATCGACCCGCTCCCCATATCC
AAGGAAAAGGAGGCCGTCCTGAGCCGCACTCGGCCTTCGTGGCTGCCACCCAAGGACCCCAATGAGGAGAAGCGC
CATCTGCGCGAGTACCAACAAATGATGGCGGCCAGCGTCAAGGCCGACGAGCGTCGCGAAGCCGCACGACGGTCC
AAGACGGAATCGAGAGACAGCAACGCCGATCACCTGATGCACGTGTGGGAGGACGACATCGTTCCCCGCTGGAAT
CAGGCCATCCGCGAGCGTCGGACGCGCGACATGTGGTGGAGAGGCATCGCCCCGCGGAGCCGCGGCCTCGTCTGG
ACGCGAGCCATTGGCAATCAGCTGGGCTTAACAGCGGCATCGTTTCAAACGGCCTTGTCTCGCGCGGGCGACGTC
GAGACACGCCTGAGAACGGACCGGGGAGACGCCGAGGACGCGAGAAGGGCAAAGTGGTTCGACCGCATTCGCAGG
GACGCGGGCGACGGAACCTGGACGGAGCTGCGCATCTTCCAACCCGGCGGGCCTCTGAACAGTGCCCTCGTTGAT
GTGCTGAGCGCGTACGCCATGTACAGGAACGACGTCGGCTACGTCTCTGGCAGCAATGTAAGCCGAGTCCGTAAC
GGCTCAATCAGTACGGATCGCTAACTCGTTTCTCTACAGGCCATCGCCGCGCTGCTCCTACTCAACCTCCCCGAC
ACGGAGACGACCTTCATCGCGCTCGCCAACCTGCTTAACCGGCCACTGCCCCTCTCGTTCCACACGTCAGACCAA
GGCGCTCAAGCCTCAGCCTTTAACCTGGTGCTGCAGACGCTCAGCAACCAGTCGCCCGCCTTGCACGACCACCTG
ACGCGCACGGTGGCAAACTTGGAGCCGGAGGAGTATCTCGGCCACATGTTCACCACCCTGTTCGCCGACCACCTT
TCCATCGACGAGGCGGCTAGGCTGTGGGACGTCTACGTGTTCGAGGGCGACGCGGTGCTTGTGCGTGCCGCTGTT
GCGGTTTTGCTACGACATGAAATGGCCCTGCTGGGCAGCAAGACGGCTGGTGAGATTCGAGCGGTCATGAGCAGA
TTGCACGGGCCATCTGGGCACGCTGTGGCGCCCGTCGGAGCTGAGGACCATTTCATGCGGTTGGTCCGCGAAGCT
GGCAAGGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail