Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05404
Gene name
Locationscaffold_06:35530..37016
Strand-
Gene length (bp)1486
Transcript length (bp)1410
Coding sequence length (bp)1410
Protein length (aa) 470

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00487 FA_desaturase Fatty acid desaturase 1.8E-25 127 414
PF11960 DUF3474 Domain of unknown function (DUF3474) 8.3E-08 65 101

GO

GO Term Description Terminal node
GO:0016717 oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water Yes
GO:0006629 lipid metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 291 310 19
2 317 339 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 348.18 169.29 527.06
Alive In ants, during behavior modification 1021.09 365.34 1676.83
Dead In ants, recently dead 521.98 227.45 816.52

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.003275 yes
Dead Fungus 0.082311 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05404
MASPVSPSGPVLQRILSDSESSAAVSPLDSPRPSLSPSSTSLSSLASADGDSKYAGLLDTYGNAFTPPDFTIKDI
RDAIPKHCFERSALTGYSYILRDMACLAITFVVFHNLVTPELIPSTPVRTALWAVYTFLQGLFGTGLWVIAHECG
HGAFSPSRLINDVTGWVLHSALLVPYFSWQISHSKHHKATGNMERDMVFVPRTRDQQASRVGALVREMGELAEDT
PIATLAHIIGQQLAGWPYYLITNVTGHNYHERQREGRGKGKSNGIGGGVNHFDPRSPLYESKDAKLIVLSDIGIG
LAVAALYMLGNRFGWYNMAIWYFVPYLWVNSWLVGITFLQHTDPSLPHYTSEEWNFVRGAAATIDREMGFIGRHL
LHGIIETHVLHHYVSSIPFYHADEATEAIRPVMGKHYRSDTEGGPLGFVRALWRSSRMCKWVEPSAEARGSAKGI
LFFRNNNGLGTRPIGAKTE*
Coding >Ophcf2|05404
ATGGCCTCTCCCGTCTCTCCCAGCGGCCCGGTGCTGCAGCGGATCTTGTCCGACTCGGAGTCGTCGGCTGCCGTC
TCGCCGTTAGACTCGCCTCGGCCATCGCTCTCGCCTTCGTCGACGTCCCTCTCGTCGCTCGCCTCGGCTGACGGC
GACTCCAAGTACGCTGGGCTCCTCGACACGTACGGAAACGCGTTTACGCCGCCCGACTTCACCATCAAGGACATC
CGCGATGCCATTCCCAAGCACTGCTTCGAGCGCTCCGCCCTGACCGGCTACTCGTACATCCTCCGCGATATGGCT
TGCCTCGCCATCACCTTTGTCGTCTTCCACAACCTCGTCACGCCCGAGTTGATCCCCTCAACGCCCGTCCGTACC
GCCCTCTGGGCCGTCTACACCTTCCTGCAGGGCCTGTTTGGCACGGGTCTCTGGGTTATTGCTCACGAGTGCGGA
CACGGTGCATTCTCCCCCTCGCGTCTCATCAACGACGTCACGGGATGGGTGCTGCACTCTGCCCTGCTCGTCCCC
TACTTCAGCTGGCAAATCTCCCACAGCAAGCACCACAAGGCCACGGGCAACATGGAACGCGACATGGTCTTCGTG
CCTCGCACCAGGGATCAGCAGGCCTCGCGTGTCGGCGCTCTTGTCCGCGAAATGGGCGAGCTGGCCGAGGACACG
CCCATTGCCACCCTTGCTCACATCATCGGACAGCAGCTCGCCGGCTGGCCCTACTACCTTATCACCAACGTCACC
GGCCACAACTATCACGAGCGTCAACGTGAGGGACGTGGCAAGGGGAAGAGCAACGGCATCGGCGGTGGTGTCAAT
CACTTTGACCCTCGCAGCCCGCTTTACGAGAGCAAGGACGCCAAGCTCATCGTCCTGAGCGACATCGGCATTGGC
CTGGCCGTCGCCGCGCTCTACATGCTCGGAAATCGCTTCGGCTGGTACAACATGGCCATCTGGTACTTTGTGCCG
TATCTCTGGGTCAACTCGTGGCTGGTGGGCATCACTTTCCTACAGCACACGGATCCGTCTCTGCCTCACTACACT
TCTGAGGAGTGGAATTTTGTGCGCGGTGCGGCTGCCACGATTGATCGTGAGATGGGCTTCATCGGCCGTCACCTG
CTGCACGGCATCATCGAGACGCATGTGCTGCACCATTATGTCAGCAGCATCCCTTTTTACCACGCAGACGAGGCC
ACCGAAGCCATCCGCCCTGTCATGGGTAAACATTACCGCTCCGACACAGAAGGTGGCCCGCTGGGCTTCGTCCGC
GCCTTGTGGAGGAGTTCCAGGATGTGCAAATGGGTTGAGCCCAGTGCCGAGGCTCGTGGATCGGCCAAGGGTATC
CTCTTCTTCCGCAACAACAATGGCTTGGGCACGAGGCCCATCGGTGCCAAGACGGAGTAA
Transcript >Ophcf2|05404
ATGGCCTCTCCCGTCTCTCCCAGCGGCCCGGTGCTGCAGCGGATCTTGTCCGACTCGGAGTCGTCGGCTGCCGTC
TCGCCGTTAGACTCGCCTCGGCCATCGCTCTCGCCTTCGTCGACGTCCCTCTCGTCGCTCGCCTCGGCTGACGGC
GACTCCAAGTACGCTGGGCTCCTCGACACGTACGGAAACGCGTTTACGCCGCCCGACTTCACCATCAAGGACATC
CGCGATGCCATTCCCAAGCACTGCTTCGAGCGCTCCGCCCTGACCGGCTACTCGTACATCCTCCGCGATATGGCT
TGCCTCGCCATCACCTTTGTCGTCTTCCACAACCTCGTCACGCCCGAGTTGATCCCCTCAACGCCCGTCCGTACC
GCCCTCTGGGCCGTCTACACCTTCCTGCAGGGCCTGTTTGGCACGGGTCTCTGGGTTATTGCTCACGAGTGCGGA
CACGGTGCATTCTCCCCCTCGCGTCTCATCAACGACGTCACGGGATGGGTGCTGCACTCTGCCCTGCTCGTCCCC
TACTTCAGCTGGCAAATCTCCCACAGCAAGCACCACAAGGCCACGGGCAACATGGAACGCGACATGGTCTTCGTG
CCTCGCACCAGGGATCAGCAGGCCTCGCGTGTCGGCGCTCTTGTCCGCGAAATGGGCGAGCTGGCCGAGGACACG
CCCATTGCCACCCTTGCTCACATCATCGGACAGCAGCTCGCCGGCTGGCCCTACTACCTTATCACCAACGTCACC
GGCCACAACTATCACGAGCGTCAACGTGAGGGACGTGGCAAGGGGAAGAGCAACGGCATCGGCGGTGGTGTCAAT
CACTTTGACCCTCGCAGCCCGCTTTACGAGAGCAAGGACGCCAAGCTCATCGTCCTGAGCGACATCGGCATTGGC
CTGGCCGTCGCCGCGCTCTACATGCTCGGAAATCGCTTCGGCTGGTACAACATGGCCATCTGGTACTTTGTGCCG
TATCTCTGGGTCAACTCGTGGCTGGTGGGCATCACTTTCCTACAGCACACGGATCCGTCTCTGCCTCACTACACT
TCTGAGGAGTGGAATTTTGTGCGCGGTGCGGCTGCCACGATTGATCGTGAGATGGGCTTCATCGGCCGTCACCTG
CTGCACGGCATCATCGAGACGCATGTGCTGCACCATTATGTCAGCAGCATCCCTTTTTACCACGCAGACGAGGCC
ACCGAAGCCATCCGCCCTGTCATGGGTAAACATTACCGCTCCGACACAGAAGGTGGCCCGCTGGGCTTCGTCCGC
GCCTTGTGGAGGAGTTCCAGGATGTGCAAATGGGTTGAGCCCAGTGCCGAGGCTCGTGGATCGGCCAAGGGTATC
CTCTTCTTCCGCAACAACAATGGCTTGGGCACGAGGCCCATCGGTGCCAAGACGGAGTAA
Gene >Ophcf2|05404
ATGGCCTCTCCCGTCTCTCCCAGCGGCCCGGTGCTGCAGCGGATCTTGTCCGACTCGGAGTCGTCGGCTGCCGTC
TCGCCGTTAGACTCGCCTCGGCCATCGCTCTCGCCTTCGTCGACGTCCCTCTCGTCGCTCGCCTCGGCTGACGGC
GACTCCAAGTACGCTGGGCTCCTCGACACGTACGGAAACGCGTTTACGCCGCCCGACTTCACCATCAAGGACATC
CGCGATGCCATTCCCAAGCACTGCTTCGAGCGCTCCGCCCTGACCGGCTACTCGTACATCCTCCGCGATATGGCT
TGCCTCGCCATCACCTTTGTCGTCTTCCACAACCTCGTCACGCCCGAGTTGATCCCCTCAACGCCCGTCCGTACC
GCCCTCTGGGCCGTCTACACCTTCCTGCAGGGCCTGTTTGGCACGGGTCTCTGGGTTATTGCTCACGAGTGCGGA
CACGGTGCATTCTCCCCCTCGCGTCTCATCAACGACGTCACGGGATGGGTGCTGCACTCTGCCCTGCTCGTCCCC
TACTTCAGCTGGCAAATCTCCCACAGCAAGCACCACAAGGCCACGGGCAACATGGAACGCGACATGGTCTTCGTG
CCTCGCACCAGGGATCAGCAGGCCTCGCGTGTCGGCGCTCTTGTCCGCGAAATGGGCGAGCTGGCCGAGGACACG
CCCATTGCCACCCTTGCTCACATCATCGGACAGCAGCTCGCCGGCTGGCCCTACTACCTTATCACCAACGTCACC
GGCCACAACTATCACGAGCGTCAACGTGAGGGACGTGGCAAGGGGAAGAGCAACGGCATCGGCGGTGGTGTCAAT
CACTTTGACCCTCGCAGCCCGCTTTACGAGAGCAAGGACGCCAAGCTCATCGTCCTGAGCGACATCGGCATTGGC
CTGGCCGTCGCCGCGCTCTACATGCTCGGAAATCGCTTCGGCTGGTACAACATGGCCATCTGGTACTTTGTGCCG
TATCTCTGGGTCAACTCGTGGCTGGGTAGGGCTCACCTCTCTCTTCTCCTTGCTCCCTCACCACATACTCGTGCT
CAATGCTAACCGAAATCTCCTGTCAGTGGGCATCACTTTCCTACAGCACACGGATCCGTCTCTGCCTCACTACAC
TTCTGAGGAGTGGAATTTTGTGCGCGGTGCGGCTGCCACGATTGATCGTGAGATGGGCTTCATCGGCCGTCACCT
GCTGCACGGCATCATCGAGACGCATGTGCTGCACCATTATGTCAGCAGCATCCCTTTTTACCACGCAGACGAGGC
CACCGAAGCCATCCGCCCTGTCATGGGTAAACATTACCGCTCCGACACAGAAGGTGGCCCGCTGGGCTTCGTCCG
CGCCTTGTGGAGGAGTTCCAGGATGTGCAAATGGGTTGAGCCCAGTGCCGAGGCTCGTGGATCGGCCAAGGGTAT
CCTCTTCTTCCGCAACAACAATGGCTTGGGCACGAGGCCCATCGGTGCCAAGACGGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail