Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05404
Gene name
Locationscaffold_06:35530..37016
Strand-
Gene length (bp)1486
Transcript length (bp)1410
Coding sequence length (bp)1410
Protein length (aa) 470

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00487 FA_desaturase Fatty acid desaturase 1.8E-25 127 414
PF11960 DUF3474 Domain of unknown function (DUF3474) 8.3E-08 65 101

GO

GO Term Description Terminal node
GO:0016717 oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water Yes
GO:0006629 lipid metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 291 310 19
2 317 339 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05404
MASPVSPSGPVLQRILSDSESSAAVSPLDSPRPSLSPSSTSLSSLASADGDSKYAGLLDTYGNAFTPPDFTIKDI
RDAIPKHCFERSALTGYSYILRDMACLAITFVVFHNLVTPELIPSTPVRTALWAVYTFLQGLFGTGLWVIAHECG
HGAFSPSRLINDVTGWVLHSALLVPYFSWQISHSKHHKATGNMERDMVFVPRTRDQQASRVGALVREMGELAEDT
PIATLAHIIGQQLAGWPYYLITNVTGHNYHERQREGRGKGKSNGIGGGVNHFDPRSPLYESKDAKLIVLSDIGIG
LAVAALYMLGNRFGWYNMAIWYFVPYLWVNSWLVGITFLQHTDPSLPHYTSEEWNFVRGAAATIDREMGFIGRHL
LHGIIETHVLHHYVSSIPFYHADEATEAIRPVMGKHYRSDTEGGPLGFVRALWRSSRMCKWVEPSAEARGSAKGI
LFFRNNNGLGTRPIGAKTE*
Coding >Ophcf2|05404
ATGGCCTCTCCCGTCTCTCCCAGCGGCCCGGTGCTGCAGCGGATCTTGTCCGACTCGGAGTCGTCGGCTGCCGTC
TCGCCGTTAGACTCGCCTCGGCCATCGCTCTCGCCTTCGTCGACGTCCCTCTCGTCGCTCGCCTCGGCTGACGGC
GACTCCAAGTACGCTGGGCTCCTCGACACGTACGGAAACGCGTTTACGCCGCCCGACTTCACCATCAAGGACATC
CGCGATGCCATTCCCAAGCACTGCTTCGAGCGCTCCGCCCTGACCGGCTACTCGTACATCCTCCGCGATATGGCT
TGCCTCGCCATCACCTTTGTCGTCTTCCACAACCTCGTCACGCCCGAGTTGATCCCCTCAACGCCCGTCCGTACC
GCCCTCTGGGCCGTCTACACCTTCCTGCAGGGCCTGTTTGGCACGGGTCTCTGGGTTATTGCTCACGAGTGCGGA
CACGGTGCATTCTCCCCCTCGCGTCTCATCAACGACGTCACGGGATGGGTGCTGCACTCTGCCCTGCTCGTCCCC
TACTTCAGCTGGCAAATCTCCCACAGCAAGCACCACAAGGCCACGGGCAACATGGAACGCGACATGGTCTTCGTG
CCTCGCACCAGGGATCAGCAGGCCTCGCGTGTCGGCGCTCTTGTCCGCGAAATGGGCGAGCTGGCCGAGGACACG
CCCATTGCCACCCTTGCTCACATCATCGGACAGCAGCTCGCCGGCTGGCCCTACTACCTTATCACCAACGTCACC
GGCCACAACTATCACGAGCGTCAACGTGAGGGACGTGGCAAGGGGAAGAGCAACGGCATCGGCGGTGGTGTCAAT
CACTTTGACCCTCGCAGCCCGCTTTACGAGAGCAAGGACGCCAAGCTCATCGTCCTGAGCGACATCGGCATTGGC
CTGGCCGTCGCCGCGCTCTACATGCTCGGAAATCGCTTCGGCTGGTACAACATGGCCATCTGGTACTTTGTGCCG
TATCTCTGGGTCAACTCGTGGCTGGTGGGCATCACTTTCCTACAGCACACGGATCCGTCTCTGCCTCACTACACT
TCTGAGGAGTGGAATTTTGTGCGCGGTGCGGCTGCCACGATTGATCGTGAGATGGGCTTCATCGGCCGTCACCTG
CTGCACGGCATCATCGAGACGCATGTGCTGCACCATTATGTCAGCAGCATCCCTTTTTACCACGCAGACGAGGCC
ACCGAAGCCATCCGCCCTGTCATGGGTAAACATTACCGCTCCGACACAGAAGGTGGCCCGCTGGGCTTCGTCCGC
GCCTTGTGGAGGAGTTCCAGGATGTGCAAATGGGTTGAGCCCAGTGCCGAGGCTCGTGGATCGGCCAAGGGTATC
CTCTTCTTCCGCAACAACAATGGCTTGGGCACGAGGCCCATCGGTGCCAAGACGGAGTAA
Transcript >Ophcf2|05404
ATGGCCTCTCCCGTCTCTCCCAGCGGCCCGGTGCTGCAGCGGATCTTGTCCGACTCGGAGTCGTCGGCTGCCGTC
TCGCCGTTAGACTCGCCTCGGCCATCGCTCTCGCCTTCGTCGACGTCCCTCTCGTCGCTCGCCTCGGCTGACGGC
GACTCCAAGTACGCTGGGCTCCTCGACACGTACGGAAACGCGTTTACGCCGCCCGACTTCACCATCAAGGACATC
CGCGATGCCATTCCCAAGCACTGCTTCGAGCGCTCCGCCCTGACCGGCTACTCGTACATCCTCCGCGATATGGCT
TGCCTCGCCATCACCTTTGTCGTCTTCCACAACCTCGTCACGCCCGAGTTGATCCCCTCAACGCCCGTCCGTACC
GCCCTCTGGGCCGTCTACACCTTCCTGCAGGGCCTGTTTGGCACGGGTCTCTGGGTTATTGCTCACGAGTGCGGA
CACGGTGCATTCTCCCCCTCGCGTCTCATCAACGACGTCACGGGATGGGTGCTGCACTCTGCCCTGCTCGTCCCC
TACTTCAGCTGGCAAATCTCCCACAGCAAGCACCACAAGGCCACGGGCAACATGGAACGCGACATGGTCTTCGTG
CCTCGCACCAGGGATCAGCAGGCCTCGCGTGTCGGCGCTCTTGTCCGCGAAATGGGCGAGCTGGCCGAGGACACG
CCCATTGCCACCCTTGCTCACATCATCGGACAGCAGCTCGCCGGCTGGCCCTACTACCTTATCACCAACGTCACC
GGCCACAACTATCACGAGCGTCAACGTGAGGGACGTGGCAAGGGGAAGAGCAACGGCATCGGCGGTGGTGTCAAT
CACTTTGACCCTCGCAGCCCGCTTTACGAGAGCAAGGACGCCAAGCTCATCGTCCTGAGCGACATCGGCATTGGC
CTGGCCGTCGCCGCGCTCTACATGCTCGGAAATCGCTTCGGCTGGTACAACATGGCCATCTGGTACTTTGTGCCG
TATCTCTGGGTCAACTCGTGGCTGGTGGGCATCACTTTCCTACAGCACACGGATCCGTCTCTGCCTCACTACACT
TCTGAGGAGTGGAATTTTGTGCGCGGTGCGGCTGCCACGATTGATCGTGAGATGGGCTTCATCGGCCGTCACCTG
CTGCACGGCATCATCGAGACGCATGTGCTGCACCATTATGTCAGCAGCATCCCTTTTTACCACGCAGACGAGGCC
ACCGAAGCCATCCGCCCTGTCATGGGTAAACATTACCGCTCCGACACAGAAGGTGGCCCGCTGGGCTTCGTCCGC
GCCTTGTGGAGGAGTTCCAGGATGTGCAAATGGGTTGAGCCCAGTGCCGAGGCTCGTGGATCGGCCAAGGGTATC
CTCTTCTTCCGCAACAACAATGGCTTGGGCACGAGGCCCATCGGTGCCAAGACGGAGTAA
Gene >Ophcf2|05404
ATGGCCTCTCCCGTCTCTCCCAGCGGCCCGGTGCTGCAGCGGATCTTGTCCGACTCGGAGTCGTCGGCTGCCGTC
TCGCCGTTAGACTCGCCTCGGCCATCGCTCTCGCCTTCGTCGACGTCCCTCTCGTCGCTCGCCTCGGCTGACGGC
GACTCCAAGTACGCTGGGCTCCTCGACACGTACGGAAACGCGTTTACGCCGCCCGACTTCACCATCAAGGACATC
CGCGATGCCATTCCCAAGCACTGCTTCGAGCGCTCCGCCCTGACCGGCTACTCGTACATCCTCCGCGATATGGCT
TGCCTCGCCATCACCTTTGTCGTCTTCCACAACCTCGTCACGCCCGAGTTGATCCCCTCAACGCCCGTCCGTACC
GCCCTCTGGGCCGTCTACACCTTCCTGCAGGGCCTGTTTGGCACGGGTCTCTGGGTTATTGCTCACGAGTGCGGA
CACGGTGCATTCTCCCCCTCGCGTCTCATCAACGACGTCACGGGATGGGTGCTGCACTCTGCCCTGCTCGTCCCC
TACTTCAGCTGGCAAATCTCCCACAGCAAGCACCACAAGGCCACGGGCAACATGGAACGCGACATGGTCTTCGTG
CCTCGCACCAGGGATCAGCAGGCCTCGCGTGTCGGCGCTCTTGTCCGCGAAATGGGCGAGCTGGCCGAGGACACG
CCCATTGCCACCCTTGCTCACATCATCGGACAGCAGCTCGCCGGCTGGCCCTACTACCTTATCACCAACGTCACC
GGCCACAACTATCACGAGCGTCAACGTGAGGGACGTGGCAAGGGGAAGAGCAACGGCATCGGCGGTGGTGTCAAT
CACTTTGACCCTCGCAGCCCGCTTTACGAGAGCAAGGACGCCAAGCTCATCGTCCTGAGCGACATCGGCATTGGC
CTGGCCGTCGCCGCGCTCTACATGCTCGGAAATCGCTTCGGCTGGTACAACATGGCCATCTGGTACTTTGTGCCG
TATCTCTGGGTCAACTCGTGGCTGGGTAGGGCTCACCTCTCTCTTCTCCTTGCTCCCTCACCACATACTCGTGCT
CAATGCTAACCGAAATCTCCTGTCAGTGGGCATCACTTTCCTACAGCACACGGATCCGTCTCTGCCTCACTACAC
TTCTGAGGAGTGGAATTTTGTGCGCGGTGCGGCTGCCACGATTGATCGTGAGATGGGCTTCATCGGCCGTCACCT
GCTGCACGGCATCATCGAGACGCATGTGCTGCACCATTATGTCAGCAGCATCCCTTTTTACCACGCAGACGAGGC
CACCGAAGCCATCCGCCCTGTCATGGGTAAACATTACCGCTCCGACACAGAAGGTGGCCCGCTGGGCTTCGTCCG
CGCCTTGTGGAGGAGTTCCAGGATGTGCAAATGGGTTGAGCCCAGTGCCGAGGCTCGTGGATCGGCCAAGGGTAT
CCTCTTCTTCCGCAACAACAATGGCTTGGGCACGAGGCCCATCGGTGCCAAGACGGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail