Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05403
Gene name
Locationscaffold_06:31325..34556
Strand-
Gene length (bp)3231
Transcript length (bp)3231
Coding sequence length (bp)3231
Protein length (aa) 1077

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00689 Cation_ATPase_C Cation transporting ATPase, C-terminus 4.2E-43 856 1062
PF00122 E1-E2_ATPase E1-E2 ATPase 1.6E-39 221 417
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 6.5E-10 435 712
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 3.1E-07 739 787
PF13246 Cation_ATPase Cation transport ATPase (P-type) 1.6E-17 484 573
PF00690 Cation_ATPase_N Cation transporter/ATPase, N-terminus 2.8E-10 104 170

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

Domain # Start End Length
1 152 174 22
2 184 206 22
3 350 372 22
4 387 409 22
5 831 853 22
6 858 880 22
7 907 929 22
8 964 986 22
9 1006 1028 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05403
MDDGRSDLEKEGGRAIVFDDDAGAGPGRGRAMGRVRSRSRPSSSRSRSRAAGLPAPSPFSGVQIEYRSLSMHVAE
STRVNNLADDKDLVKDKDDHDAYFAGLSYHKLSTHDICQQLNVSRTAGLSDEAAARRLARDGRNTLPRAKSNYAA
KLLTYLFGGFCSVLWLGVIIFFLCWKPLSNPPSVTNLALALLVLVVIFLQAGFAAFQDWSTRRTMRAIVDLLPAE
ALVVREGSKVEVQAATLVAGDVVLLRMGDKVPADLRLLSHSGDLRFDRSVLTGEPDEVEASVDATDANILESRNM
ALMGTLVVNGSGEAVVVLTGGRSVMGRIAKATAAAGQGSTLIQREVWRFVRIIVALTVVLALVILLAWLLWLRRD
HPGFMDVVAMLNNVMGCVVAFIPEGMPVAVALTLMRVARRMKAVDVLPKGLSTVETLGCVNVVCSDKTGTLTENQ
MVVRSVACVDRAVGHEHGDDEKDHHARLRRAALLCNDAVFDPASLHLPIATRKVQGNATDAAVLRFAAGSEQEKQ
APSPRLFQIPFNSSNKWMLTLHQDEDDDTRYRVLIKGAPDVLFPACERYWSPRSGGVRPLTDGDRLALSRYQDDL
AGKAERVIVLCEKTMLPVHALGTNDFAAEVTDAAVSDLTVIGILGIVDPPRPETKDTVAACRRAGARFFMVTGDY
GLTAAAIARLTGIFTGEAAPDSAETIRAVVEAGPNPDHQGIKDGSLLLDGPSLSTLSSPAHWDAICAYREVVFSR
TSPEQKLRIVTELRRRDNVVAVTGDGVNDAPALRAADVGVAVVSGSDVAIEAAHLVLLDRFDSIVDAIRLGRLVF
QNLQKVIAYLLPAGSCSEIWPVLLNVFFGVPLPLSAFLMIIICIFTDLFMSLSLIMEQQEFDLLSLPPRNHRRDH
LINAKIYVQAYLFVGLMETCTAHAMFFLYYWRHARIPIRDLFFLYERYNDGFHGYSAAELARFNATGQSVYFVTL
VILQWGNILAVRNRRLSILQADPFTSSRRNPWLLLSILISFVIAIFVTEVPGIQSLFNTASVPIEHWLIPLPLAL
GLLCMDELRKLLVRLFPKGPVAAIAW*
Coding >Ophcf2|05403
ATGGACGATGGCAGGTCGGATCTCGAGAAGGAGGGCGGCCGGGCAATCGTCTTTGACGACGATGCCGGGGCTGGA
CCCGGGCGAGGCCGCGCGATGGGAAGAGTCCGGTCCAGGAGCAGGCCTTCTTCCTCGCGGTCGAGGTCGAGGGCT
GCTGGTCTGCCGGCGCCGTCGCCTTTCTCGGGCGTGCAGATTGAGTATCGCAGCTTGTCGATGCACGTTGCTGAA
TCGACTCGCGTCAACAACCTGGCCGATGACAAGGACCTTGTCAAGGATAAGGATGATCATGACGCTTACTTTGCT
GGCCTTTCGTATCATAAGCTCTCGACGCATGACATCTGTCAACAGCTCAATGTTAGTCGGACTGCAGGTCTTTCG
GACGAGGCAGCGGCCCGGAGACTGGCGCGAGATGGTCGCAATACCCTCCCGCGCGCAAAGTCCAACTACGCTGCT
AAGCTGCTAACTTACCTCTTTGGCGGCTTCTGTTCCGTTCTCTGGCTCGGTGTCATCATCTTCTTCCTGTGTTGG
AAGCCGCTCAGCAACCCGCCTTCGGTCACGAACCTTGCGCTCGCGCTGCTGGTGCTCGTCGTTATATTCCTGCAG
GCCGGCTTCGCGGCTTTTCAGGATTGGTCGACGCGGAGGACCATGAGGGCCATTGTCGATCTGTTGCCGGCAGAG
GCCTTGGTTGTCAGGGAGGGGAGCAAGGTCGAGGTTCAGGCCGCGACGTTGGTGGCTGGGGATGTGGTGCTGTTG
AGGATGGGGGACAAGGTGCCGGCTGATTTGAGGCTTTTGAGCCATTCTGGAGATCTTCGGTTCGATCGGTCCGTA
CTGACGGGCGAGCCGGATGAGGTTGAGGCTTCCGTGGATGCTACTGATGCGAATATCCTCGAGAGTCGAAACATG
GCACTCATGGGCACCCTCGTCGTCAACGGCTCGGGCGAGGCTGTCGTCGTCCTCACAGGGGGAAGATCCGTCATG
GGGAGGATAGCAAAGGCGACAGCGGCAGCGGGACAGGGCTCAACGCTAATCCAGCGAGAAGTCTGGCGCTTCGTC
CGCATCATCGTCGCGCTGACGGTGGTGCTGGCTCTCGTCATCTTGCTGGCTTGGCTGCTATGGCTACGACGCGAC
CATCCGGGCTTCATGGATGTGGTGGCCATGCTGAACAATGTCATGGGCTGTGTTGTCGCCTTTATACCCGAGGGG
ATGCCGGTTGCCGTGGCCCTGACGTTGATGAGGGTCGCGCGAAGGATGAAGGCTGTTGATGTGTTGCCCAAGGGG
TTGTCGACGGTCGAGACGCTGGGCTGTGTGAATGTGGTTTGCTCGGATAAGACGGGGACGTTGACGGAGAACCAG
ATGGTTGTGAGGAGTGTTGCTTGCGTTGATCGGGCTGTTGGGCATGAGCATGGGGATGATGAAAAGGACCATCAT
GCCCGTCTCCGAAGAGCAGCTCTCCTCTGCAACGACGCCGTCTTCGACCCGGCATCGCTTCACCTCCCCATCGCC
ACCCGCAAAGTCCAAGGAAACGCCACCGACGCCGCCGTTCTTCGTTTCGCCGCTGGCTCGGAACAGGAGAAGCAA
GCGCCGTCACCGCGCCTCTTTCAGATCCCCTTCAACTCGAGCAACAAGTGGATGCTCACCCTCCACCAAGACGAA
GACGACGATACGCGGTATCGTGTTCTCATAAAGGGGGCGCCGGATGTTCTATTCCCGGCTTGTGAGCGTTACTGG
TCTCCTCGATCAGGAGGCGTCAGACCCCTTACGGACGGAGACCGGCTCGCTTTGAGTCGCTATCAAGATGATCTG
GCGGGTAAAGCAGAACGGGTCATCGTCCTCTGTGAAAAGACGATGCTGCCCGTTCACGCGCTGGGAACAAACGAC
TTCGCCGCCGAGGTCACCGACGCGGCTGTCTCGGACCTCACCGTCATCGGCATCCTCGGCATCGTCGATCCGCCC
CGGCCCGAGACCAAGGATACCGTCGCGGCCTGTCGTCGTGCGGGCGCGCGATTCTTCATGGTCACGGGCGATTAT
GGTCTTACTGCTGCGGCCATTGCGAGATTGACGGGCATCTTTACCGGTGAGGCGGCCCCGGACTCGGCGGAGACG
ATCCGGGCTGTCGTCGAGGCCGGTCCGAATCCCGACCATCAAGGCATCAAGGATGGTAGCCTCCTCCTCGACGGT
CCTTCGCTCTCGACACTCTCATCTCCCGCTCACTGGGACGCCATCTGCGCCTACCGCGAAGTCGTCTTCTCTCGC
ACCTCGCCCGAGCAAAAACTTCGCATCGTGACTGAGCTCCGACGCCGCGATAACGTCGTCGCCGTCACGGGAGAC
GGAGTCAATGATGCGCCCGCCCTCCGAGCAGCGGACGTGGGCGTCGCCGTCGTCTCCGGAAGCGACGTCGCCATC
GAGGCCGCTCATCTGGTCCTCCTCGATCGCTTCGACTCCATCGTTGATGCTATCCGTCTCGGTCGCCTGGTCTTT
CAGAACTTGCAAAAAGTCATTGCTTACTTGCTTCCTGCTGGCTCGTGCTCCGAGATCTGGCCCGTGCTGCTCAAC
GTCTTCTTTGGCGTTCCGCTTCCCCTGAGCGCCTTTCTGATGATCATCATCTGCATCTTCACTGACCTCTTCATG
TCCCTCTCCCTCATCATGGAACAGCAGGAGTTTGACCTGCTATCGCTACCGCCTCGTAACCATCGACGCGATCAT
CTCATCAACGCCAAGATCTACGTCCAAGCTTACCTCTTCGTCGGCCTCATGGAGACTTGCACTGCCCACGCCATG
TTCTTCCTCTACTACTGGCGTCACGCCCGCATCCCCATACGCGACCTCTTCTTTCTCTACGAGCGCTATAACGAT
GGCTTCCACGGCTACAGTGCCGCTGAGCTCGCTCGCTTCAACGCAACCGGCCAGTCCGTCTACTTCGTCACTCTT
GTCATCCTGCAATGGGGCAACATCCTTGCCGTCCGCAACCGCCGGCTCAGCATCCTGCAGGCCGATCCCTTCACC
TCGAGCCGGAGAAACCCGTGGCTGCTACTGAGCATCCTCATCAGCTTCGTCATTGCCATCTTCGTCACCGAGGTA
CCAGGCATTCAGTCCCTTTTCAACACCGCTTCGGTGCCCATTGAGCACTGGCTGATCCCCTTGCCGTTGGCCTTG
GGTCTTCTCTGTATGGATGAGCTACGCAAGCTACTGGTCCGTCTCTTTCCCAAGGGGCCGGTGGCTGCCATAGCC
TGGTAG
Transcript >Ophcf2|05403
ATGGACGATGGCAGGTCGGATCTCGAGAAGGAGGGCGGCCGGGCAATCGTCTTTGACGACGATGCCGGGGCTGGA
CCCGGGCGAGGCCGCGCGATGGGAAGAGTCCGGTCCAGGAGCAGGCCTTCTTCCTCGCGGTCGAGGTCGAGGGCT
GCTGGTCTGCCGGCGCCGTCGCCTTTCTCGGGCGTGCAGATTGAGTATCGCAGCTTGTCGATGCACGTTGCTGAA
TCGACTCGCGTCAACAACCTGGCCGATGACAAGGACCTTGTCAAGGATAAGGATGATCATGACGCTTACTTTGCT
GGCCTTTCGTATCATAAGCTCTCGACGCATGACATCTGTCAACAGCTCAATGTTAGTCGGACTGCAGGTCTTTCG
GACGAGGCAGCGGCCCGGAGACTGGCGCGAGATGGTCGCAATACCCTCCCGCGCGCAAAGTCCAACTACGCTGCT
AAGCTGCTAACTTACCTCTTTGGCGGCTTCTGTTCCGTTCTCTGGCTCGGTGTCATCATCTTCTTCCTGTGTTGG
AAGCCGCTCAGCAACCCGCCTTCGGTCACGAACCTTGCGCTCGCGCTGCTGGTGCTCGTCGTTATATTCCTGCAG
GCCGGCTTCGCGGCTTTTCAGGATTGGTCGACGCGGAGGACCATGAGGGCCATTGTCGATCTGTTGCCGGCAGAG
GCCTTGGTTGTCAGGGAGGGGAGCAAGGTCGAGGTTCAGGCCGCGACGTTGGTGGCTGGGGATGTGGTGCTGTTG
AGGATGGGGGACAAGGTGCCGGCTGATTTGAGGCTTTTGAGCCATTCTGGAGATCTTCGGTTCGATCGGTCCGTA
CTGACGGGCGAGCCGGATGAGGTTGAGGCTTCCGTGGATGCTACTGATGCGAATATCCTCGAGAGTCGAAACATG
GCACTCATGGGCACCCTCGTCGTCAACGGCTCGGGCGAGGCTGTCGTCGTCCTCACAGGGGGAAGATCCGTCATG
GGGAGGATAGCAAAGGCGACAGCGGCAGCGGGACAGGGCTCAACGCTAATCCAGCGAGAAGTCTGGCGCTTCGTC
CGCATCATCGTCGCGCTGACGGTGGTGCTGGCTCTCGTCATCTTGCTGGCTTGGCTGCTATGGCTACGACGCGAC
CATCCGGGCTTCATGGATGTGGTGGCCATGCTGAACAATGTCATGGGCTGTGTTGTCGCCTTTATACCCGAGGGG
ATGCCGGTTGCCGTGGCCCTGACGTTGATGAGGGTCGCGCGAAGGATGAAGGCTGTTGATGTGTTGCCCAAGGGG
TTGTCGACGGTCGAGACGCTGGGCTGTGTGAATGTGGTTTGCTCGGATAAGACGGGGACGTTGACGGAGAACCAG
ATGGTTGTGAGGAGTGTTGCTTGCGTTGATCGGGCTGTTGGGCATGAGCATGGGGATGATGAAAAGGACCATCAT
GCCCGTCTCCGAAGAGCAGCTCTCCTCTGCAACGACGCCGTCTTCGACCCGGCATCGCTTCACCTCCCCATCGCC
ACCCGCAAAGTCCAAGGAAACGCCACCGACGCCGCCGTTCTTCGTTTCGCCGCTGGCTCGGAACAGGAGAAGCAA
GCGCCGTCACCGCGCCTCTTTCAGATCCCCTTCAACTCGAGCAACAAGTGGATGCTCACCCTCCACCAAGACGAA
GACGACGATACGCGGTATCGTGTTCTCATAAAGGGGGCGCCGGATGTTCTATTCCCGGCTTGTGAGCGTTACTGG
TCTCCTCGATCAGGAGGCGTCAGACCCCTTACGGACGGAGACCGGCTCGCTTTGAGTCGCTATCAAGATGATCTG
GCGGGTAAAGCAGAACGGGTCATCGTCCTCTGTGAAAAGACGATGCTGCCCGTTCACGCGCTGGGAACAAACGAC
TTCGCCGCCGAGGTCACCGACGCGGCTGTCTCGGACCTCACCGTCATCGGCATCCTCGGCATCGTCGATCCGCCC
CGGCCCGAGACCAAGGATACCGTCGCGGCCTGTCGTCGTGCGGGCGCGCGATTCTTCATGGTCACGGGCGATTAT
GGTCTTACTGCTGCGGCCATTGCGAGATTGACGGGCATCTTTACCGGTGAGGCGGCCCCGGACTCGGCGGAGACG
ATCCGGGCTGTCGTCGAGGCCGGTCCGAATCCCGACCATCAAGGCATCAAGGATGGTAGCCTCCTCCTCGACGGT
CCTTCGCTCTCGACACTCTCATCTCCCGCTCACTGGGACGCCATCTGCGCCTACCGCGAAGTCGTCTTCTCTCGC
ACCTCGCCCGAGCAAAAACTTCGCATCGTGACTGAGCTCCGACGCCGCGATAACGTCGTCGCCGTCACGGGAGAC
GGAGTCAATGATGCGCCCGCCCTCCGAGCAGCGGACGTGGGCGTCGCCGTCGTCTCCGGAAGCGACGTCGCCATC
GAGGCCGCTCATCTGGTCCTCCTCGATCGCTTCGACTCCATCGTTGATGCTATCCGTCTCGGTCGCCTGGTCTTT
CAGAACTTGCAAAAAGTCATTGCTTACTTGCTTCCTGCTGGCTCGTGCTCCGAGATCTGGCCCGTGCTGCTCAAC
GTCTTCTTTGGCGTTCCGCTTCCCCTGAGCGCCTTTCTGATGATCATCATCTGCATCTTCACTGACCTCTTCATG
TCCCTCTCCCTCATCATGGAACAGCAGGAGTTTGACCTGCTATCGCTACCGCCTCGTAACCATCGACGCGATCAT
CTCATCAACGCCAAGATCTACGTCCAAGCTTACCTCTTCGTCGGCCTCATGGAGACTTGCACTGCCCACGCCATG
TTCTTCCTCTACTACTGGCGTCACGCCCGCATCCCCATACGCGACCTCTTCTTTCTCTACGAGCGCTATAACGAT
GGCTTCCACGGCTACAGTGCCGCTGAGCTCGCTCGCTTCAACGCAACCGGCCAGTCCGTCTACTTCGTCACTCTT
GTCATCCTGCAATGGGGCAACATCCTTGCCGTCCGCAACCGCCGGCTCAGCATCCTGCAGGCCGATCCCTTCACC
TCGAGCCGGAGAAACCCGTGGCTGCTACTGAGCATCCTCATCAGCTTCGTCATTGCCATCTTCGTCACCGAGGTA
CCAGGCATTCAGTCCCTTTTCAACACCGCTTCGGTGCCCATTGAGCACTGGCTGATCCCCTTGCCGTTGGCCTTG
GGTCTTCTCTGTATGGATGAGCTACGCAAGCTACTGGTCCGTCTCTTTCCCAAGGGGCCGGTGGCTGCCATAGCC
TGGTAG
Gene >Ophcf2|05403
ATGGACGATGGCAGGTCGGATCTCGAGAAGGAGGGCGGCCGGGCAATCGTCTTTGACGACGATGCCGGGGCTGGA
CCCGGGCGAGGCCGCGCGATGGGAAGAGTCCGGTCCAGGAGCAGGCCTTCTTCCTCGCGGTCGAGGTCGAGGGCT
GCTGGTCTGCCGGCGCCGTCGCCTTTCTCGGGCGTGCAGATTGAGTATCGCAGCTTGTCGATGCACGTTGCTGAA
TCGACTCGCGTCAACAACCTGGCCGATGACAAGGACCTTGTCAAGGATAAGGATGATCATGACGCTTACTTTGCT
GGCCTTTCGTATCATAAGCTCTCGACGCATGACATCTGTCAACAGCTCAATGTTAGTCGGACTGCAGGTCTTTCG
GACGAGGCAGCGGCCCGGAGACTGGCGCGAGATGGTCGCAATACCCTCCCGCGCGCAAAGTCCAACTACGCTGCT
AAGCTGCTAACTTACCTCTTTGGCGGCTTCTGTTCCGTTCTCTGGCTCGGTGTCATCATCTTCTTCCTGTGTTGG
AAGCCGCTCAGCAACCCGCCTTCGGTCACGAACCTTGCGCTCGCGCTGCTGGTGCTCGTCGTTATATTCCTGCAG
GCCGGCTTCGCGGCTTTTCAGGATTGGTCGACGCGGAGGACCATGAGGGCCATTGTCGATCTGTTGCCGGCAGAG
GCCTTGGTTGTCAGGGAGGGGAGCAAGGTCGAGGTTCAGGCCGCGACGTTGGTGGCTGGGGATGTGGTGCTGTTG
AGGATGGGGGACAAGGTGCCGGCTGATTTGAGGCTTTTGAGCCATTCTGGAGATCTTCGGTTCGATCGGTCCGTA
CTGACGGGCGAGCCGGATGAGGTTGAGGCTTCCGTGGATGCTACTGATGCGAATATCCTCGAGAGTCGAAACATG
GCACTCATGGGCACCCTCGTCGTCAACGGCTCGGGCGAGGCTGTCGTCGTCCTCACAGGGGGAAGATCCGTCATG
GGGAGGATAGCAAAGGCGACAGCGGCAGCGGGACAGGGCTCAACGCTAATCCAGCGAGAAGTCTGGCGCTTCGTC
CGCATCATCGTCGCGCTGACGGTGGTGCTGGCTCTCGTCATCTTGCTGGCTTGGCTGCTATGGCTACGACGCGAC
CATCCGGGCTTCATGGATGTGGTGGCCATGCTGAACAATGTCATGGGCTGTGTTGTCGCCTTTATACCCGAGGGG
ATGCCGGTTGCCGTGGCCCTGACGTTGATGAGGGTCGCGCGAAGGATGAAGGCTGTTGATGTGTTGCCCAAGGGG
TTGTCGACGGTCGAGACGCTGGGCTGTGTGAATGTGGTTTGCTCGGATAAGACGGGGACGTTGACGGAGAACCAG
ATGGTTGTGAGGAGTGTTGCTTGCGTTGATCGGGCTGTTGGGCATGAGCATGGGGATGATGAAAAGGACCATCAT
GCCCGTCTCCGAAGAGCAGCTCTCCTCTGCAACGACGCCGTCTTCGACCCGGCATCGCTTCACCTCCCCATCGCC
ACCCGCAAAGTCCAAGGAAACGCCACCGACGCCGCCGTTCTTCGTTTCGCCGCTGGCTCGGAACAGGAGAAGCAA
GCGCCGTCACCGCGCCTCTTTCAGATCCCCTTCAACTCGAGCAACAAGTGGATGCTCACCCTCCACCAAGACGAA
GACGACGATACGCGGTATCGTGTTCTCATAAAGGGGGCGCCGGATGTTCTATTCCCGGCTTGTGAGCGTTACTGG
TCTCCTCGATCAGGAGGCGTCAGACCCCTTACGGACGGAGACCGGCTCGCTTTGAGTCGCTATCAAGATGATCTG
GCGGGTAAAGCAGAACGGGTCATCGTCCTCTGTGAAAAGACGATGCTGCCCGTTCACGCGCTGGGAACAAACGAC
TTCGCCGCCGAGGTCACCGACGCGGCTGTCTCGGACCTCACCGTCATCGGCATCCTCGGCATCGTCGATCCGCCC
CGGCCCGAGACCAAGGATACCGTCGCGGCCTGTCGTCGTGCGGGCGCGCGATTCTTCATGGTCACGGGCGATTAT
GGTCTTACTGCTGCGGCCATTGCGAGATTGACGGGCATCTTTACCGGTGAGGCGGCCCCGGACTCGGCGGAGACG
ATCCGGGCTGTCGTCGAGGCCGGTCCGAATCCCGACCATCAAGGCATCAAGGATGGTAGCCTCCTCCTCGACGGT
CCTTCGCTCTCGACACTCTCATCTCCCGCTCACTGGGACGCCATCTGCGCCTACCGCGAAGTCGTCTTCTCTCGC
ACCTCGCCCGAGCAAAAACTTCGCATCGTGACTGAGCTCCGACGCCGCGATAACGTCGTCGCCGTCACGGGAGAC
GGAGTCAATGATGCGCCCGCCCTCCGAGCAGCGGACGTGGGCGTCGCCGTCGTCTCCGGAAGCGACGTCGCCATC
GAGGCCGCTCATCTGGTCCTCCTCGATCGCTTCGACTCCATCGTTGATGCTATCCGTCTCGGTCGCCTGGTCTTT
CAGAACTTGCAAAAAGTCATTGCTTACTTGCTTCCTGCTGGCTCGTGCTCCGAGATCTGGCCCGTGCTGCTCAAC
GTCTTCTTTGGCGTTCCGCTTCCCCTGAGCGCCTTTCTGATGATCATCATCTGCATCTTCACTGACCTCTTCATG
TCCCTCTCCCTCATCATGGAACAGCAGGAGTTTGACCTGCTATCGCTACCGCCTCGTAACCATCGACGCGATCAT
CTCATCAACGCCAAGATCTACGTCCAAGCTTACCTCTTCGTCGGCCTCATGGAGACTTGCACTGCCCACGCCATG
TTCTTCCTCTACTACTGGCGTCACGCCCGCATCCCCATACGCGACCTCTTCTTTCTCTACGAGCGCTATAACGAT
GGCTTCCACGGCTACAGTGCCGCTGAGCTCGCTCGCTTCAACGCAACCGGCCAGTCCGTCTACTTCGTCACTCTT
GTCATCCTGCAATGGGGCAACATCCTTGCCGTCCGCAACCGCCGGCTCAGCATCCTGCAGGCCGATCCCTTCACC
TCGAGCCGGAGAAACCCGTGGCTGCTACTGAGCATCCTCATCAGCTTCGTCATTGCCATCTTCGTCACCGAGGTA
CCAGGCATTCAGTCCCTTTTCAACACCGCTTCGGTGCCCATTGAGCACTGGCTGATCCCCTTGCCGTTGGCCTTG
GGTCTTCTCTGTATGGATGAGCTACGCAAGCTACTGGTCCGTCTCTTTCCCAAGGGGCCGGTGGCTGCCATAGCC
TGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail