Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05402
Gene name
Locationscaffold_06:27455..30694
Strand+
Gene length (bp)3239
Transcript length (bp)2220
Coding sequence length (bp)2220
Protein length (aa) 740

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06011 TRP Transient receptor potential (TRP) ion channel 2.8E-142 246 676
PF14558 TRP_N ML-like domain 3.8E-40 101 241

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

Domain # Start End Length
1 248 270 22
2 283 305 22
3 397 419 22
4 448 470 22
5 480 502 22
6 529 551 22
7 566 585 19
8 597 619 22
9 629 651 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05402
MRTIYDDDSSLSADRTSSLPLTAYIQTGHKDQDQRNRRGPSLGPSVNAHSAAVVVTSSARHSNIFEFRQSRKFRE
RSNMRPKLLLLAAAASPLATAERMLLSNSLNSCQEDSAFTASHFNVVYTPNNNSATVKMHVTSTIEGDVMFDVAI
SAYGYTFFRKPVDPCDMKLDGLCPMVPGKSNQQFNLPIDPESAKQIPAIAFTIPDLDANVRIFVNKTSSDKKTIG
SSVSCLEASISNGKTVNLTGVKWATAVIAALALLSSAVFNGLGHFNAAAHVAANSLSLFSFFQAQAIIGLTSVPL
PPIVQAWTLNFQWSMGIIRSKVVLGICTWYQRATGGTPSRIFSALRTVSVHVTKRSLDAADKQLVKRGDITHGET
GAYTVYGIQRVAFQSKIKSTDLFMTGLIFFYLLFVITGLAVASVKGILELCRRKKWTSRFIDFRNGWRTIIKGIF
YRLALLTYPQMSILCLWEFTQADSAAEVVIAVVIFFGLTSVLFWGASRLILIARRSVTLHQNPAYILFADPKVLN
KWGFLYIQFRASAYYFIFPTLGYILVKSMLVALGQHSSRGIAQAVGIFLLETGALIAASIMRPWMDKSTNSFNIA
ICAVNFLNAICLLVFTNVLGAPGLVVGVFSIIFFILNASFSLVLLILLLLTTTLTFFQKNPDARYQIMGDDRASF
VKSTPQVNATMELEALAATARGEKLKGTQSKEERESLFRGHRQMGYREASPSAVYNRSGSSLSR*
Coding >Ophcf2|05402
ATGCGTACTATATACGACGATGACTCTTCGTTATCGGCAGATCGGACGAGTTCTCTGCCGTTGACCGCATACATA
CAAACAGGGCATAAAGACCAGGATCAAAGAAATCGTCGCGGCCCCTCGCTGGGACCGTCAGTGAACGCCCATTCT
GCTGCGGTCGTTGTCACGTCTTCTGCACGACACAGCAACATCTTCGAGTTCCGACAAAGCCGAAAGTTCCGAGAG
AGAAGCAACATGAGGCCAAAATTGTTGCTGCTCGCCGCGGCCGCGTCGCCACTGGCCACAGCGGAACGGATGCTC
TTGTCCAACTCGCTCAACTCTTGCCAGGAGGACAGCGCCTTCACGGCCTCACATTTCAATGTTGTCTACACGCCG
AATAATAACTCGGCCACGGTCAAGATGCATGTTACATCGACCATTGAGGGCGATGTCATGTTCGACGTTGCAATC
TCCGCCTACGGCTATACCTTCTTTCGCAAGCCTGTCGACCCGTGTGATATGAAACTCGACGGTCTCTGTCCCATG
GTGCCCGGCAAGAGTAACCAGCAATTCAACTTGCCTATCGATCCGGAAAGCGCGAAGCAGATTCCCGCCATTGCC
TTCACGATTCCTGATCTGGATGCCAACGTCCGCATCTTCGTCAACAAGACCTCGTCAGACAAGAAGACGATAGGG
TCTAGCGTTTCCTGTCTCGAGGCCTCCATTTCCAATGGGAAAACCGTCAATCTTACGGGCGTGAAATGGGCTACG
GCGGTTATTGCTGCCTTGGCCCTCCTGTCGTCCGCCGTGTTTAACGGGCTCGGTCACTTCAACGCAGCTGCTCAC
GTAGCCGCCAACTCCCTGTCGCTCTTTAGCTTTTTTCAGGCTCAGGCTATTATAGGCCTCACCAGCGTCCCCCTT
CCCCCTATCGTGCAAGCCTGGACTCTCAACTTCCAGTGGTCGATGGGTATCATTCGATCCAAAGTCGTGCTGGGC
ATTTGCACCTGGTATCAACGAGCAACAGGCGGAACGCCATCACGAATCTTTAGCGCCTTGAGGACCGTTTCCGTC
CACGTCACTAAACGGTCTCTCGATGCTGCGGACAAGCAACTGGTCAAGCGAGGCGACATCACACATGGCGAAACC
GGCGCCTACACCGTCTACGGCATTCAGCGCGTGGCATTCCAATCTAAGATCAAGTCCACTGACCTCTTCATGACG
GGCTTGATCTTCTTCTATCTCCTCTTCGTCATAACCGGTCTGGCCGTGGCATCTGTCAAGGGAATCCTGGAACTT
TGTCGCCGGAAGAAATGGACGAGTAGATTCATCGACTTCCGCAACGGGTGGCGAACCATCATCAAGGGCATTTTC
TACCGGCTGGCTCTTCTCACCTACCCGCAGATGAGCATTCTCTGCCTCTGGGAATTCACGCAGGCTGATTCTGCC
GCCGAAGTCGTCATCGCCGTCGTTATATTCTTCGGTCTAACCAGCGTTCTCTTCTGGGGAGCCAGCAGACTCATC
CTCATCGCCCGTCGCTCCGTCACTCTACATCAGAACCCGGCGTACATCTTATTCGCTGATCCCAAGGTTCTTAAC
AAATGGGGATTCCTATACATTCAGTTCAGAGCCTCGGCGTACTATTTCATCTTTCCAACTCTCGGATATATCCTC
GTCAAGTCGATGCTCGTGGCCCTTGGACAACATAGCAGCCGCGGCATTGCGCAGGCCGTTGGAATCTTTTTGCTC
GAAACGGGCGCCTTGATCGCTGCGTCGATTATGCGTCCGTGGATGGATAAAAGCACGAATTCCTTCAACATTGCC
ATCTGCGCCGTCAACTTCTTAAACGCCATCTGTCTACTAGTTTTTACAAACGTTCTCGGAGCGCCCGGTCTTGTC
GTCGGAGTCTTTAGCATCATCTTCTTTATCCTCAACGCCTCCTTCTCGCTTGTCCTCCTCATCCTACTCCTCTTA
ACCACAACGCTCACCTTCTTCCAGAAGAACCCGGATGCCCGTTACCAGATCATGGGTGACGATCGGGCGTCGTTT
GTCAAGTCTACGCCGCAGGTGAATGCAACGATGGAGCTCGAGGCTCTGGCTGCGACGGCTAGGGGTGAAAAGCTT
AAGGGGACGCAGTCGAAGGAAGAGAGGGAGAGTCTGTTCCGCGGACACCGGCAGATGGGTTATCGCGAGGCGTCG
CCGAGTGCGGTATATAATCGTTCTGGATCATCATTGAGCCGGTAA
Transcript >Ophcf2|05402
ATGCGTACTATATACGACGATGACTCTTCGTTATCGGCAGATCGGACGAGTTCTCTGCCGTTGACCGCATACATA
CAAACAGGGCATAAAGACCAGGATCAAAGAAATCGTCGCGGCCCCTCGCTGGGACCGTCAGTGAACGCCCATTCT
GCTGCGGTCGTTGTCACGTCTTCTGCACGACACAGCAACATCTTCGAGTTCCGACAAAGCCGAAAGTTCCGAGAG
AGAAGCAACATGAGGCCAAAATTGTTGCTGCTCGCCGCGGCCGCGTCGCCACTGGCCACAGCGGAACGGATGCTC
TTGTCCAACTCGCTCAACTCTTGCCAGGAGGACAGCGCCTTCACGGCCTCACATTTCAATGTTGTCTACACGCCG
AATAATAACTCGGCCACGGTCAAGATGCATGTTACATCGACCATTGAGGGCGATGTCATGTTCGACGTTGCAATC
TCCGCCTACGGCTATACCTTCTTTCGCAAGCCTGTCGACCCGTGTGATATGAAACTCGACGGTCTCTGTCCCATG
GTGCCCGGCAAGAGTAACCAGCAATTCAACTTGCCTATCGATCCGGAAAGCGCGAAGCAGATTCCCGCCATTGCC
TTCACGATTCCTGATCTGGATGCCAACGTCCGCATCTTCGTCAACAAGACCTCGTCAGACAAGAAGACGATAGGG
TCTAGCGTTTCCTGTCTCGAGGCCTCCATTTCCAATGGGAAAACCGTCAATCTTACGGGCGTGAAATGGGCTACG
GCGGTTATTGCTGCCTTGGCCCTCCTGTCGTCCGCCGTGTTTAACGGGCTCGGTCACTTCAACGCAGCTGCTCAC
GTAGCCGCCAACTCCCTGTCGCTCTTTAGCTTTTTTCAGGCTCAGGCTATTATAGGCCTCACCAGCGTCCCCCTT
CCCCCTATCGTGCAAGCCTGGACTCTCAACTTCCAGTGGTCGATGGGTATCATTCGATCCAAAGTCGTGCTGGGC
ATTTGCACCTGGTATCAACGAGCAACAGGCGGAACGCCATCACGAATCTTTAGCGCCTTGAGGACCGTTTCCGTC
CACGTCACTAAACGGTCTCTCGATGCTGCGGACAAGCAACTGGTCAAGCGAGGCGACATCACACATGGCGAAACC
GGCGCCTACACCGTCTACGGCATTCAGCGCGTGGCATTCCAATCTAAGATCAAGTCCACTGACCTCTTCATGACG
GGCTTGATCTTCTTCTATCTCCTCTTCGTCATAACCGGTCTGGCCGTGGCATCTGTCAAGGGAATCCTGGAACTT
TGTCGCCGGAAGAAATGGACGAGTAGATTCATCGACTTCCGCAACGGGTGGCGAACCATCATCAAGGGCATTTTC
TACCGGCTGGCTCTTCTCACCTACCCGCAGATGAGCATTCTCTGCCTCTGGGAATTCACGCAGGCTGATTCTGCC
GCCGAAGTCGTCATCGCCGTCGTTATATTCTTCGGTCTAACCAGCGTTCTCTTCTGGGGAGCCAGCAGACTCATC
CTCATCGCCCGTCGCTCCGTCACTCTACATCAGAACCCGGCGTACATCTTATTCGCTGATCCCAAGGTTCTTAAC
AAATGGGGATTCCTATACATTCAGTTCAGAGCCTCGGCGTACTATTTCATCTTTCCAACTCTCGGATATATCCTC
GTCAAGTCGATGCTCGTGGCCCTTGGACAACATAGCAGCCGCGGCATTGCGCAGGCCGTTGGAATCTTTTTGCTC
GAAACGGGCGCCTTGATCGCTGCGTCGATTATGCGTCCGTGGATGGATAAAAGCACGAATTCCTTCAACATTGCC
ATCTGCGCCGTCAACTTCTTAAACGCCATCTGTCTACTAGTTTTTACAAACGTTCTCGGAGCGCCCGGTCTTGTC
GTCGGAGTCTTTAGCATCATCTTCTTTATCCTCAACGCCTCCTTCTCGCTTGTCCTCCTCATCCTACTCCTCTTA
ACCACAACGCTCACCTTCTTCCAGAAGAACCCGGATGCCCGTTACCAGATCATGGGTGACGATCGGGCGTCGTTT
GTCAAGTCTACGCCGCAGGTGAATGCAACGATGGAGCTCGAGGCTCTGGCTGCGACGGCTAGGGGTGAAAAGCTT
AAGGGGACGCAGTCGAAGGAAGAGAGGGAGAGTCTGTTCCGCGGACACCGGCAGATGGGTTATCGCGAGGCGTCG
CCGAGTGCGGTATATAATCGTTCTGGATCATCATTGAGCCGGTAA
Gene >Ophcf2|05402
ATGCGTACTATATACGACGATGACTGTGAGCCCTTGCTTGTCTGTTCCTCAGGTAGAATTCCGAGTCACGAACAA
GCTGCAGAAGTCCTCAGATTCGATGAAGGGTTAAAAAGCGAGGATGCCATGTTACGGAAGGCGCAGAACAGATGG
GAAAGTTTCGATGGGGGCATTGGTTAGCTGAAGATCAGCTGCTGTTTCTGATGCTTTTGAGTTATGTACATACAT
ACATACTTATGCACGTCTTGTAGGGAGTCTGATGGGGTCACGCGGAGTAGCGGAAGGTTATAGATAGGGTAGCTG
ACACTACTCATGTCTTGCTACTTATGATTACCTTCTTGAGAGTGCTGGAATTTGTAGAGCTGCGTAGAGTTTCGG
AAAGTTAGCTGCTCTTGCAGCACCACCATTGCAGGTGGTAATGCAAAGATAAGTCCTAAAGAATTACATAGTTCA
ACTGACGCAGATCGTAGGCAAGTGTCCGAACAAGGCAGAAAGCCTCGGCCCGCATCGCCTCCCTCACATCAAAGG
GGCAGTTCTCCCATTCACCATGACCCTATTTGACAAGAGAGTGGAACCACACTATAACTGTACATATGTACATAC
ATACACCTGAAAGCCGTGCCACTACAATAATAACAGATTCCCACTTGTGCCACCTCTATCATGCGCGGCTCTACA
GTGGAGCAGACTCCTTTATGCCGCCCCCAGGTATCACGGGTTCCCTTCCAGCATCTAGCAACTTAAACTTTGCTG
ATCCAGCCGCTGCTCGTATTTGCCGTCGCGTCCCCGTTCCTCTGCAAGCGCTAACGAGCGAGGCTGTGCCATCGA
TCCTTGAAACGTTGCGTGCTCTCCCACGCCTCGTATAATCCCATTCGCCCAGTCGAACCGTGGGAGAAGCCTTAC
CCCCTTTTCTCCTCTTGCTGCTTCTTTCTAGCAGTCAACAACGAGGGTGACGGGGAACAAAACGCTCGCGACACT
TGCGGACTCGCAGCTTCGTTATCGGCAGATCGGACGAGTTCTCTGCCGTTGACCGCATACATACAAACAGGGCAT
AAAGACCAGGATCAAAGAAATCGTCGCGGCCCCTCGCTGGGACCGTCAGTGAACGCCCATTCTGCTGCGGTCGTT
GTCACGTCTTGTGGGTCTGGAGTTGTTTTTCGGCTTTGATCGTGGATGTTGACCGGTGGGTTGCAGCTGCACGAC
ACAGCAACATCTTCGAGTTCCGACAAAGCCGAAAGTTCCGAGAGAGAAGCAACATGAGGCCAAAATTGTTGCTGC
TCGCCGCGGCCGCGTCGCCACTGGCCACAGCGGAACGGATGCTCTTGTCCAACTCGCTCAACTCTTGCCAGGAGG
ACAGCGCCTTCACGGCCTCACATTTCAATGTTGTCTACACGCCGAATAATAACTCGGCCACGGTCAAGATGCATG
TTACATCGACCATTGAGGGCGATGTCATGTTCGACGTTGCAATCTCCGCCTACGGCTATACCTTCTTTCGCAAGC
CTGTCGACCCGTGTGATATGAAACTCGACGGTCTCTGTCCCATGGTGCCCGGCAAGAGTAACCAGCAATTCAACT
TGCCTATCGATCCGGAAAGCGCGAAGCAGATTCCCGCCATTGCCTTCACGATTCCTGATCTGGATGCCAACGTCC
GCATCTTCGTCAACAAGACCTCGTCAGACAAGAAGACGATAGGGTCTAGCGTTTCCTGTCTCGAGGCCTCCATTT
CCAATGGGAAAACCGTCAATCTTACGGGCGTGAAATGGGCTACGGCGGTTATTGCTGCCTTGGCCCTCCTGTCGT
CCGCCGTGTTTAACGGGCTCGGTCACTTCAACGCAGCTGCTCACGTAGCCGCCAACTCCCTGTCGCTCTTTAGCT
TTTTTCAGGCTCAGGCTATTATAGGCCTCACCAGCGTCCCCCTTCCCCCTATCGTGCAAGCCTGGACTCTCAACT
TCCAGTGGTCGATGGGTATCATTCGATCCAAAGTCGTGCTGGGCATTTGCACCTGGTATCAACGAGCAACAGGCG
GAACGCCATCACGAATCTTTAGCGCCTTGAGGACCGTTTCCGTCCACGTCACTAAACGGTCTCTCGATGCTGCGG
ACAAGCAACTGGTCAAGCGAGGCGACATCACACATGGCGAAACCGGCGCCTACACCGTCTACGGCATTCAGCGCG
TGGCATTCCAATCTAAGATCAAGTCCACTGACCTCTTCATGACGGGCTTGATCTTCTTCTATCTCCTCTTCGTCA
TAACCGGTCTGGCCGTGGCATCTGTCAAGGGAATCCTGGAACTTTGTCGCCGGAAGAAATGGACGAGTAGATTCA
TCGACTTCCGCAACGGGTGGCGAACCATCATCAAGGGCATTTTCTACCGGCTGGCTCTTCTCACCTACCCGCAGA
TGAGCATTCTCTGCCTCTGGGAATTCACGCAGGCTGATTCTGCCGCCGAAGTCGTCATCGCCGTCGTTATATTCT
TCGGTCTAACCAGCGTTCTCTTCTGGGGAGCCAGCAGACTCATCCTCATCGCCCGTCGCTCCGTCACTCTACATC
AGAACCCGGCGTACATCTTATTCGCTGATCCCAAGGTTCTTAACAAATGGGGATTCCTATACATTCAGTTCAGAG
CCTCGGCGTACTATTTCATCTTTCCAACTCTCGGATATATCCTCGTCAAGTCGATGCTCGTGGCCCTTGGACAAC
ATAGCAGCCGCGGCATTGCGCAGGCCGTTGGAATCTTTTTGCTCGAAACGGGCGCCTTGATCGCTGCGTCGATTA
TGCGTCCGTGGATGGATAAAAGCACGAATTCCTTCAACATTGCCATCTGCGCCGTCAACTTCTTAAACGCCATCT
GTCTACTAGTTTTTACAAACGTTCTCGGAGCGCCCGGTCTTGTCGTCGGAGTCTTTAGCATCATCTTCTTTATCC
TCAACGCCTCCTTCTCGCTTGTCCTCCTCATCCTACTCCTCTTAACCACAACGCTCACCTTCTTCCAGAAGAACC
CGGATGCCCGTTACCAGATCATGGGTGACGATCGGGCGTCGTTTGTCAAGTCTACGCCGCAGGTGAATGCAACGA
TGGAGCTCGAGGCTCTGGCTGCGACGGCTAGGGGTGAAAAGCTTAAGGGGACGCAGTCGAAGGAAGAGAGGGAGA
GTCTGTTCCGCGGACACCGGCAGATGGGTTATCGCGAGGCGTCGCCGAGTGCGGTATATAATCGTTCTGGATCAT
CATTGAGCCGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail