Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05397
Gene name
Locationscaffold_05:3579691..3581500
Strand+
Gene length (bp)1809
Transcript length (bp)1758
Coding sequence length (bp)1758
Protein length (aa) 586

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04113 Gpi16 Gpi16 subunit, GPI transamidase component 4.6E-235 14 574

GO

GO Term Description Terminal node
GO:0042765 GPI-anchor transamidase complex Yes
GO:0016255 attachment of GPI anchor to protein Yes
GO:0019538 protein metabolic process No
GO:1905368 peptidase complex No
GO:0036211 protein modification process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008303 caspase complex No
GO:0032991 protein-containing complex No
GO:0140534 endoplasmic reticulum protein-containing complex No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005575 cellular_component No
GO:0006807 nitrogen compound metabolic process No
GO:1905369 endopeptidase complex No
GO:0043412 macromolecule modification No
GO:0098796 membrane protein complex No
GO:0008150 biological_process No
GO:1902494 catalytic complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 530 552 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 98.42 55.07 141.77
Alive In ants, during behavior modification 78.22 43.54 112.89
Dead In ants, recently dead 71.79 40.69 102.88

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.255773 no
Alive Dead 0.658901 no
Dead Fungus 0.106397 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05397
MRCPPALLFVANLVASLASFAAAADYHEQLTLRPLPLSALLASFNFRSNTSLADFEAHHFRLFPRSLAQILQHAR
TRELHLRFTLGRWDAERWGARPWGGVREGGTGVELWAWLDRDADDNWRTLTNALSGLFCASLNFIDSTRTTRPVV
SFQPEGNHSNATLGTTSLLHGVLPHEVVCTENLTPFLKLLPCKGKAGIASLLDGHKLFDASFQSMAIDVRPVCDS
HGVCVLQMEQTIDMVLDVERSKRPRDNPIPRPPPSQKLLCDTSKAYHGDGVCFPTDHLHGQHWKLSEIFGRAMRG
VCPLTDGITPPVCLQVPDSRFVFATGASRDLRDTSGMSRCYTPDEDGVEFNFELTKPSSTDAAASKDLVRPETPL
LYAERSFMGHGQEHGGVQAILTNPGDAEVEFVYMESLPWFMRIYLHTLSTRISSSSVATNASSRIIEEIYYRPAL
DRTRGTQLELLMRIPPLCTVFLTYDFSKSILRYTEYPPDANRGFDVAAAVITTRAPHAGLNLRTTSLLLYLPTPD
FSMPYNVIIFTSTAIALTFGGLYNILVRRLVGADEAPNTMLKTKVARLLCLLKTRLQGST*
Coding >Ophcf2|05397
ATGCGTTGCCCTCCTGCACTCCTCTTCGTCGCGAATCTCGTGGCCAGCCTCGCGAGCTTCGCTGCCGCTGCCGAT
TACCACGAGCAGCTCACTCTACGCCCGCTACCGCTCTCCGCTCTCCTCGCGAGCTTCAACTTTCGATCCAATACG
TCTCTCGCCGACTTCGAGGCTCATCACTTTCGTCTCTTCCCCCGATCTCTGGCCCAAATTCTACAGCATGCTCGC
ACACGCGAGCTCCATCTGCGCTTCACCCTCGGCCGCTGGGACGCCGAGCGATGGGGCGCTCGGCCCTGGGGAGGT
GTTCGCGAGGGTGGCACCGGAGTCGAGCTGTGGGCTTGGCTGGACAGAGACGCTGACGATAACTGGCGGACACTG
ACCAACGCCCTGTCTGGCCTCTTCTGCGCTTCGCTCAACTTCATCGACTCGACGCGCACGACTCGCCCCGTCGTT
TCTTTTCAACCTGAGGGAAATCACTCAAACGCCACTCTCGGCACCACGAGCCTGCTTCACGGCGTGCTCCCTCAC
GAGGTCGTTTGTACCGAAAATTTGACGCCCTTCCTCAAGCTGCTGCCCTGCAAGGGGAAGGCTGGAATCGCCAGT
CTGCTAGATGGACACAAGCTGTTTGACGCCTCGTTCCAGAGCATGGCTATTGATGTGAGGCCCGTCTGCGACTCT
CATGGCGTCTGTGTTCTTCAGATGGAACAGACCATCGACATGGTGCTGGATGTCGAACGCTCCAAGCGACCAAGA
GATAACCCCATTCCGAGACCTCCCCCCAGCCAGAAGCTTCTCTGTGACACGTCCAAGGCCTACCACGGTGATGGG
GTCTGCTTCCCAACCGATCATCTGCATGGCCAACATTGGAAGCTATCCGAAATCTTCGGCCGCGCCATGAGGGGC
GTGTGTCCGTTGACCGACGGCATCACGCCTCCAGTGTGTTTGCAGGTCCCCGACTCCCGATTCGTGTTCGCCACC
GGCGCCTCCCGCGATCTCAGAGACACCAGCGGAATGTCAAGGTGTTACACACCGGATGAAGACGGCGTCGAGTTC
AACTTTGAGCTCACGAAACCAAGCTCTACTGACGCGGCGGCATCCAAGGACCTGGTCCGGCCGGAGACGCCGCTT
CTTTACGCTGAACGAAGCTTCATGGGCCATGGCCAGGAACACGGCGGCGTTCAGGCCATATTGACCAACCCCGGT
GACGCCGAGGTCGAGTTTGTCTATATGGAATCGCTTCCCTGGTTCATGCGAATCTACCTCCACACACTATCCACG
CGTATCTCGTCCTCGTCGGTCGCCACAAACGCCTCGTCGCGCATCATCGAGGAGATCTACTACCGTCCGGCTCTC
GACCGCACCCGCGGCACTCAGCTGGAGCTCCTCATGCGCATCCCCCCCCTCTGCACCGTTTTTCTCACCTACGAC
TTCTCCAAGTCCATCCTGCGGTATACCGAGTATCCGCCCGACGCCAACCGCGGCTTCGACGTCGCCGCCGCCGTC
ATCACCACTCGCGCTCCGCATGCTGGCCTCAACTTGCGCACTACCAGCCTGTTGCTATATCTGCCGACGCCGGAC
TTTTCCATGCCGTACAATGTCATCATCTTCACCTCGACGGCTATAGCTCTGACCTTTGGCGGCTTGTACAACATC
CTTGTTAGAAGGCTGGTGGGAGCAGACGAGGCGCCGAATACGATGCTCAAGACCAAGGTCGCGCGGCTTCTGTGT
CTGCTTAAGACGCGTCTGCAAGGGAGCACTTGA
Transcript >Ophcf2|05397
ATGCGTTGCCCTCCTGCACTCCTCTTCGTCGCGAATCTCGTGGCCAGCCTCGCGAGCTTCGCTGCCGCTGCCGAT
TACCACGAGCAGCTCACTCTACGCCCGCTACCGCTCTCCGCTCTCCTCGCGAGCTTCAACTTTCGATCCAATACG
TCTCTCGCCGACTTCGAGGCTCATCACTTTCGTCTCTTCCCCCGATCTCTGGCCCAAATTCTACAGCATGCTCGC
ACACGCGAGCTCCATCTGCGCTTCACCCTCGGCCGCTGGGACGCCGAGCGATGGGGCGCTCGGCCCTGGGGAGGT
GTTCGCGAGGGTGGCACCGGAGTCGAGCTGTGGGCTTGGCTGGACAGAGACGCTGACGATAACTGGCGGACACTG
ACCAACGCCCTGTCTGGCCTCTTCTGCGCTTCGCTCAACTTCATCGACTCGACGCGCACGACTCGCCCCGTCGTT
TCTTTTCAACCTGAGGGAAATCACTCAAACGCCACTCTCGGCACCACGAGCCTGCTTCACGGCGTGCTCCCTCAC
GAGGTCGTTTGTACCGAAAATTTGACGCCCTTCCTCAAGCTGCTGCCCTGCAAGGGGAAGGCTGGAATCGCCAGT
CTGCTAGATGGACACAAGCTGTTTGACGCCTCGTTCCAGAGCATGGCTATTGATGTGAGGCCCGTCTGCGACTCT
CATGGCGTCTGTGTTCTTCAGATGGAACAGACCATCGACATGGTGCTGGATGTCGAACGCTCCAAGCGACCAAGA
GATAACCCCATTCCGAGACCTCCCCCCAGCCAGAAGCTTCTCTGTGACACGTCCAAGGCCTACCACGGTGATGGG
GTCTGCTTCCCAACCGATCATCTGCATGGCCAACATTGGAAGCTATCCGAAATCTTCGGCCGCGCCATGAGGGGC
GTGTGTCCGTTGACCGACGGCATCACGCCTCCAGTGTGTTTGCAGGTCCCCGACTCCCGATTCGTGTTCGCCACC
GGCGCCTCCCGCGATCTCAGAGACACCAGCGGAATGTCAAGGTGTTACACACCGGATGAAGACGGCGTCGAGTTC
AACTTTGAGCTCACGAAACCAAGCTCTACTGACGCGGCGGCATCCAAGGACCTGGTCCGGCCGGAGACGCCGCTT
CTTTACGCTGAACGAAGCTTCATGGGCCATGGCCAGGAACACGGCGGCGTTCAGGCCATATTGACCAACCCCGGT
GACGCCGAGGTCGAGTTTGTCTATATGGAATCGCTTCCCTGGTTCATGCGAATCTACCTCCACACACTATCCACG
CGTATCTCGTCCTCGTCGGTCGCCACAAACGCCTCGTCGCGCATCATCGAGGAGATCTACTACCGTCCGGCTCTC
GACCGCACCCGCGGCACTCAGCTGGAGCTCCTCATGCGCATCCCCCCCCTCTGCACCGTTTTTCTCACCTACGAC
TTCTCCAAGTCCATCCTGCGGTATACCGAGTATCCGCCCGACGCCAACCGCGGCTTCGACGTCGCCGCCGCCGTC
ATCACCACTCGCGCTCCGCATGCTGGCCTCAACTTGCGCACTACCAGCCTGTTGCTATATCTGCCGACGCCGGAC
TTTTCCATGCCGTACAATGTCATCATCTTCACCTCGACGGCTATAGCTCTGACCTTTGGCGGCTTGTACAACATC
CTTGTTAGAAGGCTGGTGGGAGCAGACGAGGCGCCGAATACGATGCTCAAGACCAAGGTCGCGCGGCTTCTGTGT
CTGCTTAAGACGCGTCTGCAAGGGAGCACTTGA
Gene >Ophcf2|05397
ATGCGTTGCCCTCCTGCACTCCTCTTCGTCGCGAATCTCGTGGCCAGCCTCGCGAGCTTCGCTGCCGCTGCCGAT
TACCACGAGCAGCTCACTCTACGCCCGCTACCGCTCTCCGCTCTCCTCGCGAGCTTCAACTTTCGATCCAATACG
TCTCTCGCCGACTTCGAGGCTCATCACTTTCGTCTCTTCCCCCGATCTCTGGCCCAAATTCTACAGCATGCTCGC
ACACGCGAGCTCCATCTGCGCTTCACCCTCGGCCGCTGGGACGCCGAGCGATGGGGCGCTCGGCCCTGGGGAGGT
GTTCGCGAGGGTGGCACCGGAGTCGAGCTGTGGGCTTGGCTGGACAGAGACGCTGACGATAACTGGCGGACACTG
ACCAACGCCCTGTCTGGCCTCTTCTGCGCTTCGCTCAACTTCATCGACTCGACGCGCACGACTCGCCCCGTCGTT
TCTTTTCAACCTGAGGGAAATCACTCAAACGCCACTCTCGGCACCACGAGCCTGCTTCACGGCGTGCTCCCTCAC
GAGGTCGTTTGTACCGAAAATTTGACGCCCTTCCTCAAGCTGCTGCCCTGCAAGGGGAAGGCTGGAATCGCCAGT
CTGCTAGATGGACACAAGCTGTTTGACGCCTCGTTCCAGAGCATGGCTATTGATGTGAGGCCCGTCTGCGACTCT
CATGGCGTCTGTGTTCTTCAGATGGAACAGACCATCGACATGGTGCTGGATGTCGAACGCTCCAAGCGACCAAGA
GGTTCGCTCTTCTCTTCCCCACCCCGAGAGTTGCAGTCTGACTGGCTATTAGATAACCCCATTCCGAGACCTCCC
CCCAGCCAGAAGCTTCTCTGTGACACGTCCAAGGCCTACCACGGTGATGGGGTCTGCTTCCCAACCGATCATCTG
CATGGCCAACATTGGAAGCTATCCGAAATCTTCGGCCGCGCCATGAGGGGCGTGTGTCCGTTGACCGACGGCATC
ACGCCTCCAGTGTGTTTGCAGGTCCCCGACTCCCGATTCGTGTTCGCCACCGGCGCCTCCCGCGATCTCAGAGAC
ACCAGCGGAATGTCAAGGTGTTACACACCGGATGAAGACGGCGTCGAGTTCAACTTTGAGCTCACGAAACCAAGC
TCTACTGACGCGGCGGCATCCAAGGACCTGGTCCGGCCGGAGACGCCGCTTCTTTACGCTGAACGAAGCTTCATG
GGCCATGGCCAGGAACACGGCGGCGTTCAGGCCATATTGACCAACCCCGGTGACGCCGAGGTCGAGTTTGTCTAT
ATGGAATCGCTTCCCTGGTTCATGCGAATCTACCTCCACACACTATCCACGCGTATCTCGTCCTCGTCGGTCGCC
ACAAACGCCTCGTCGCGCATCATCGAGGAGATCTACTACCGTCCGGCTCTCGACCGCACCCGCGGCACTCAGCTG
GAGCTCCTCATGCGCATCCCCCCCCTCTGCACCGTTTTTCTCACCTACGACTTCTCCAAGTCCATCCTGCGGTAT
ACCGAGTATCCGCCCGACGCCAACCGCGGCTTCGACGTCGCCGCCGCCGTCATCACCACTCGCGCTCCGCATGCT
GGCCTCAACTTGCGCACTACCAGCCTGTTGCTATATCTGCCGACGCCGGACTTTTCCATGCCGTACAATGTCATC
ATCTTCACCTCGACGGCTATAGCTCTGACCTTTGGCGGCTTGTACAACATCCTTGTTAGAAGGCTGGTGGGAGCA
GACGAGGCGCCGAATACGATGCTCAAGACCAAGGTCGCGCGGCTTCTGTGTCTGCTTAAGACGCGTCTGCAAGGG
AGCACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail