Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05397
Gene name
Locationscaffold_05:3579691..3581500
Strand+
Gene length (bp)1809
Transcript length (bp)1758
Coding sequence length (bp)1758
Protein length (aa) 586

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04113 Gpi16 Gpi16 subunit, GPI transamidase component 4.6E-235 14 574

GO

GO Term Description Terminal node
GO:0042765 GPI-anchor transamidase complex Yes
GO:0016255 attachment of GPI anchor to protein Yes
GO:0019538 protein metabolic process No
GO:1905368 peptidase complex No
GO:0036211 protein modification process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008303 caspase complex No
GO:0032991 protein-containing complex No
GO:0140534 endoplasmic reticulum protein-containing complex No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005575 cellular_component No
GO:0006807 nitrogen compound metabolic process No
GO:1905369 endopeptidase complex No
GO:0043412 macromolecule modification No
GO:0098796 membrane protein complex No
GO:0008150 biological_process No
GO:1902494 catalytic complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 530 552 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05397
MRCPPALLFVANLVASLASFAAAADYHEQLTLRPLPLSALLASFNFRSNTSLADFEAHHFRLFPRSLAQILQHAR
TRELHLRFTLGRWDAERWGARPWGGVREGGTGVELWAWLDRDADDNWRTLTNALSGLFCASLNFIDSTRTTRPVV
SFQPEGNHSNATLGTTSLLHGVLPHEVVCTENLTPFLKLLPCKGKAGIASLLDGHKLFDASFQSMAIDVRPVCDS
HGVCVLQMEQTIDMVLDVERSKRPRDNPIPRPPPSQKLLCDTSKAYHGDGVCFPTDHLHGQHWKLSEIFGRAMRG
VCPLTDGITPPVCLQVPDSRFVFATGASRDLRDTSGMSRCYTPDEDGVEFNFELTKPSSTDAAASKDLVRPETPL
LYAERSFMGHGQEHGGVQAILTNPGDAEVEFVYMESLPWFMRIYLHTLSTRISSSSVATNASSRIIEEIYYRPAL
DRTRGTQLELLMRIPPLCTVFLTYDFSKSILRYTEYPPDANRGFDVAAAVITTRAPHAGLNLRTTSLLLYLPTPD
FSMPYNVIIFTSTAIALTFGGLYNILVRRLVGADEAPNTMLKTKVARLLCLLKTRLQGST*
Coding >Ophcf2|05397
ATGCGTTGCCCTCCTGCACTCCTCTTCGTCGCGAATCTCGTGGCCAGCCTCGCGAGCTTCGCTGCCGCTGCCGAT
TACCACGAGCAGCTCACTCTACGCCCGCTACCGCTCTCCGCTCTCCTCGCGAGCTTCAACTTTCGATCCAATACG
TCTCTCGCCGACTTCGAGGCTCATCACTTTCGTCTCTTCCCCCGATCTCTGGCCCAAATTCTACAGCATGCTCGC
ACACGCGAGCTCCATCTGCGCTTCACCCTCGGCCGCTGGGACGCCGAGCGATGGGGCGCTCGGCCCTGGGGAGGT
GTTCGCGAGGGTGGCACCGGAGTCGAGCTGTGGGCTTGGCTGGACAGAGACGCTGACGATAACTGGCGGACACTG
ACCAACGCCCTGTCTGGCCTCTTCTGCGCTTCGCTCAACTTCATCGACTCGACGCGCACGACTCGCCCCGTCGTT
TCTTTTCAACCTGAGGGAAATCACTCAAACGCCACTCTCGGCACCACGAGCCTGCTTCACGGCGTGCTCCCTCAC
GAGGTCGTTTGTACCGAAAATTTGACGCCCTTCCTCAAGCTGCTGCCCTGCAAGGGGAAGGCTGGAATCGCCAGT
CTGCTAGATGGACACAAGCTGTTTGACGCCTCGTTCCAGAGCATGGCTATTGATGTGAGGCCCGTCTGCGACTCT
CATGGCGTCTGTGTTCTTCAGATGGAACAGACCATCGACATGGTGCTGGATGTCGAACGCTCCAAGCGACCAAGA
GATAACCCCATTCCGAGACCTCCCCCCAGCCAGAAGCTTCTCTGTGACACGTCCAAGGCCTACCACGGTGATGGG
GTCTGCTTCCCAACCGATCATCTGCATGGCCAACATTGGAAGCTATCCGAAATCTTCGGCCGCGCCATGAGGGGC
GTGTGTCCGTTGACCGACGGCATCACGCCTCCAGTGTGTTTGCAGGTCCCCGACTCCCGATTCGTGTTCGCCACC
GGCGCCTCCCGCGATCTCAGAGACACCAGCGGAATGTCAAGGTGTTACACACCGGATGAAGACGGCGTCGAGTTC
AACTTTGAGCTCACGAAACCAAGCTCTACTGACGCGGCGGCATCCAAGGACCTGGTCCGGCCGGAGACGCCGCTT
CTTTACGCTGAACGAAGCTTCATGGGCCATGGCCAGGAACACGGCGGCGTTCAGGCCATATTGACCAACCCCGGT
GACGCCGAGGTCGAGTTTGTCTATATGGAATCGCTTCCCTGGTTCATGCGAATCTACCTCCACACACTATCCACG
CGTATCTCGTCCTCGTCGGTCGCCACAAACGCCTCGTCGCGCATCATCGAGGAGATCTACTACCGTCCGGCTCTC
GACCGCACCCGCGGCACTCAGCTGGAGCTCCTCATGCGCATCCCCCCCCTCTGCACCGTTTTTCTCACCTACGAC
TTCTCCAAGTCCATCCTGCGGTATACCGAGTATCCGCCCGACGCCAACCGCGGCTTCGACGTCGCCGCCGCCGTC
ATCACCACTCGCGCTCCGCATGCTGGCCTCAACTTGCGCACTACCAGCCTGTTGCTATATCTGCCGACGCCGGAC
TTTTCCATGCCGTACAATGTCATCATCTTCACCTCGACGGCTATAGCTCTGACCTTTGGCGGCTTGTACAACATC
CTTGTTAGAAGGCTGGTGGGAGCAGACGAGGCGCCGAATACGATGCTCAAGACCAAGGTCGCGCGGCTTCTGTGT
CTGCTTAAGACGCGTCTGCAAGGGAGCACTTGA
Transcript >Ophcf2|05397
ATGCGTTGCCCTCCTGCACTCCTCTTCGTCGCGAATCTCGTGGCCAGCCTCGCGAGCTTCGCTGCCGCTGCCGAT
TACCACGAGCAGCTCACTCTACGCCCGCTACCGCTCTCCGCTCTCCTCGCGAGCTTCAACTTTCGATCCAATACG
TCTCTCGCCGACTTCGAGGCTCATCACTTTCGTCTCTTCCCCCGATCTCTGGCCCAAATTCTACAGCATGCTCGC
ACACGCGAGCTCCATCTGCGCTTCACCCTCGGCCGCTGGGACGCCGAGCGATGGGGCGCTCGGCCCTGGGGAGGT
GTTCGCGAGGGTGGCACCGGAGTCGAGCTGTGGGCTTGGCTGGACAGAGACGCTGACGATAACTGGCGGACACTG
ACCAACGCCCTGTCTGGCCTCTTCTGCGCTTCGCTCAACTTCATCGACTCGACGCGCACGACTCGCCCCGTCGTT
TCTTTTCAACCTGAGGGAAATCACTCAAACGCCACTCTCGGCACCACGAGCCTGCTTCACGGCGTGCTCCCTCAC
GAGGTCGTTTGTACCGAAAATTTGACGCCCTTCCTCAAGCTGCTGCCCTGCAAGGGGAAGGCTGGAATCGCCAGT
CTGCTAGATGGACACAAGCTGTTTGACGCCTCGTTCCAGAGCATGGCTATTGATGTGAGGCCCGTCTGCGACTCT
CATGGCGTCTGTGTTCTTCAGATGGAACAGACCATCGACATGGTGCTGGATGTCGAACGCTCCAAGCGACCAAGA
GATAACCCCATTCCGAGACCTCCCCCCAGCCAGAAGCTTCTCTGTGACACGTCCAAGGCCTACCACGGTGATGGG
GTCTGCTTCCCAACCGATCATCTGCATGGCCAACATTGGAAGCTATCCGAAATCTTCGGCCGCGCCATGAGGGGC
GTGTGTCCGTTGACCGACGGCATCACGCCTCCAGTGTGTTTGCAGGTCCCCGACTCCCGATTCGTGTTCGCCACC
GGCGCCTCCCGCGATCTCAGAGACACCAGCGGAATGTCAAGGTGTTACACACCGGATGAAGACGGCGTCGAGTTC
AACTTTGAGCTCACGAAACCAAGCTCTACTGACGCGGCGGCATCCAAGGACCTGGTCCGGCCGGAGACGCCGCTT
CTTTACGCTGAACGAAGCTTCATGGGCCATGGCCAGGAACACGGCGGCGTTCAGGCCATATTGACCAACCCCGGT
GACGCCGAGGTCGAGTTTGTCTATATGGAATCGCTTCCCTGGTTCATGCGAATCTACCTCCACACACTATCCACG
CGTATCTCGTCCTCGTCGGTCGCCACAAACGCCTCGTCGCGCATCATCGAGGAGATCTACTACCGTCCGGCTCTC
GACCGCACCCGCGGCACTCAGCTGGAGCTCCTCATGCGCATCCCCCCCCTCTGCACCGTTTTTCTCACCTACGAC
TTCTCCAAGTCCATCCTGCGGTATACCGAGTATCCGCCCGACGCCAACCGCGGCTTCGACGTCGCCGCCGCCGTC
ATCACCACTCGCGCTCCGCATGCTGGCCTCAACTTGCGCACTACCAGCCTGTTGCTATATCTGCCGACGCCGGAC
TTTTCCATGCCGTACAATGTCATCATCTTCACCTCGACGGCTATAGCTCTGACCTTTGGCGGCTTGTACAACATC
CTTGTTAGAAGGCTGGTGGGAGCAGACGAGGCGCCGAATACGATGCTCAAGACCAAGGTCGCGCGGCTTCTGTGT
CTGCTTAAGACGCGTCTGCAAGGGAGCACTTGA
Gene >Ophcf2|05397
ATGCGTTGCCCTCCTGCACTCCTCTTCGTCGCGAATCTCGTGGCCAGCCTCGCGAGCTTCGCTGCCGCTGCCGAT
TACCACGAGCAGCTCACTCTACGCCCGCTACCGCTCTCCGCTCTCCTCGCGAGCTTCAACTTTCGATCCAATACG
TCTCTCGCCGACTTCGAGGCTCATCACTTTCGTCTCTTCCCCCGATCTCTGGCCCAAATTCTACAGCATGCTCGC
ACACGCGAGCTCCATCTGCGCTTCACCCTCGGCCGCTGGGACGCCGAGCGATGGGGCGCTCGGCCCTGGGGAGGT
GTTCGCGAGGGTGGCACCGGAGTCGAGCTGTGGGCTTGGCTGGACAGAGACGCTGACGATAACTGGCGGACACTG
ACCAACGCCCTGTCTGGCCTCTTCTGCGCTTCGCTCAACTTCATCGACTCGACGCGCACGACTCGCCCCGTCGTT
TCTTTTCAACCTGAGGGAAATCACTCAAACGCCACTCTCGGCACCACGAGCCTGCTTCACGGCGTGCTCCCTCAC
GAGGTCGTTTGTACCGAAAATTTGACGCCCTTCCTCAAGCTGCTGCCCTGCAAGGGGAAGGCTGGAATCGCCAGT
CTGCTAGATGGACACAAGCTGTTTGACGCCTCGTTCCAGAGCATGGCTATTGATGTGAGGCCCGTCTGCGACTCT
CATGGCGTCTGTGTTCTTCAGATGGAACAGACCATCGACATGGTGCTGGATGTCGAACGCTCCAAGCGACCAAGA
GGTTCGCTCTTCTCTTCCCCACCCCGAGAGTTGCAGTCTGACTGGCTATTAGATAACCCCATTCCGAGACCTCCC
CCCAGCCAGAAGCTTCTCTGTGACACGTCCAAGGCCTACCACGGTGATGGGGTCTGCTTCCCAACCGATCATCTG
CATGGCCAACATTGGAAGCTATCCGAAATCTTCGGCCGCGCCATGAGGGGCGTGTGTCCGTTGACCGACGGCATC
ACGCCTCCAGTGTGTTTGCAGGTCCCCGACTCCCGATTCGTGTTCGCCACCGGCGCCTCCCGCGATCTCAGAGAC
ACCAGCGGAATGTCAAGGTGTTACACACCGGATGAAGACGGCGTCGAGTTCAACTTTGAGCTCACGAAACCAAGC
TCTACTGACGCGGCGGCATCCAAGGACCTGGTCCGGCCGGAGACGCCGCTTCTTTACGCTGAACGAAGCTTCATG
GGCCATGGCCAGGAACACGGCGGCGTTCAGGCCATATTGACCAACCCCGGTGACGCCGAGGTCGAGTTTGTCTAT
ATGGAATCGCTTCCCTGGTTCATGCGAATCTACCTCCACACACTATCCACGCGTATCTCGTCCTCGTCGGTCGCC
ACAAACGCCTCGTCGCGCATCATCGAGGAGATCTACTACCGTCCGGCTCTCGACCGCACCCGCGGCACTCAGCTG
GAGCTCCTCATGCGCATCCCCCCCCTCTGCACCGTTTTTCTCACCTACGACTTCTCCAAGTCCATCCTGCGGTAT
ACCGAGTATCCGCCCGACGCCAACCGCGGCTTCGACGTCGCCGCCGCCGTCATCACCACTCGCGCTCCGCATGCT
GGCCTCAACTTGCGCACTACCAGCCTGTTGCTATATCTGCCGACGCCGGACTTTTCCATGCCGTACAATGTCATC
ATCTTCACCTCGACGGCTATAGCTCTGACCTTTGGCGGCTTGTACAACATCCTTGTTAGAAGGCTGGTGGGAGCA
GACGAGGCGCCGAATACGATGCTCAAGACCAAGGTCGCGCGGCTTCTGTGTCTGCTTAAGACGCGTCTGCAAGGG
AGCACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail