Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05389
Gene name
Locationscaffold_05:3560029..3560673
Strand+
Gene length (bp)644
Transcript length (bp)552
Coding sequence length (bp)552
Protein length (aa) 184

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain 8.3E-17 4 106
PF01479 S4 S4 domain 3.0E-13 109 153

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0019843 rRNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4329 0.5237 0.0095 0.021 0.3149 0.0254 0.0214 0.0631 0.0191 0.0016

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2354
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4164
Ophiocordyceps australis map64 (Brazil) OphauB2|6414
Ophiocordyceps camponoti-floridani Ophcf2|05389 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4340
Ophiocordyceps kimflemingae Ophio5|5630
Ophiocordyceps subramaniannii Hirsu2|3245

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05389
MVRKLKYHEQKLLRKTDFITYKQDKDHRDKAVARRYMIQKPEDYHRYNRICGSLRQLAHRLTLLPPDNKTRQKLE
TQLLDKLYDMGILSTRTKLSSVEKGATVSAFARRRLPVVMTRLRMAPTVQAATRLIEQGQVRVGTEPVTDPAYLV
TRGREDFVTWVVGSGVKRNIMKYRDQLDDFELL*
Coding >Ophcf2|05389
ATGGTCCGCAAACTCAAATACCACGAGCAGAAGCTCCTGCGAAAAACAGATTTCATCACATACAAGCAGGACAAG
GACCATCGCGACAAGGCGGTTGCGCGACGGTACATGATCCAGAAGCCCGAGGACTACCACCGCTATAACCGCATC
TGCGGCTCTCTTCGGCAATTGGCACATCGCCTCACCCTCCTCCCACCGGACAACAAAACCCGCCAAAAGCTCGAA
ACGCAGCTGCTGGACAAGCTCTACGACATGGGCATCCTGTCGACGCGCACGAAGCTATCGTCGGTGGAAAAGGGC
GCGACGGTCAGCGCCTTCGCCCGCCGTCGTCTGCCCGTCGTCATGACGAGGTTGAGGATGGCGCCTACTGTTCAG
GCGGCTACCCGGTTGATCGAGCAGGGGCAGGTGCGCGTGGGGACGGAGCCTGTTACCGATCCGGCGTATTTGGTT
ACGAGGGGAAGGGAGGATTTCGTGACGTGGGTTGTTGGGAGTGGGGTTAAGAGGAATATCATGAAGTACCGGGAT
CAGCTCGATGATTTCGAGTTGCTTTAG
Transcript >Ophcf2|05389
ATGGTCCGCAAACTCAAATACCACGAGCAGAAGCTCCTGCGAAAAACAGATTTCATCACATACAAGCAGGACAAG
GACCATCGCGACAAGGCGGTTGCGCGACGGTACATGATCCAGAAGCCCGAGGACTACCACCGCTATAACCGCATC
TGCGGCTCTCTTCGGCAATTGGCACATCGCCTCACCCTCCTCCCACCGGACAACAAAACCCGCCAAAAGCTCGAA
ACGCAGCTGCTGGACAAGCTCTACGACATGGGCATCCTGTCGACGCGCACGAAGCTATCGTCGGTGGAAAAGGGC
GCGACGGTCAGCGCCTTCGCCCGCCGTCGTCTGCCCGTCGTCATGACGAGGTTGAGGATGGCGCCTACTGTTCAG
GCGGCTACCCGGTTGATCGAGCAGGGGCAGGTGCGCGTGGGGACGGAGCCTGTTACCGATCCGGCGTATTTGGTT
ACGAGGGGAAGGGAGGATTTCGTGACGTGGGTTGTTGGGAGTGGGGTTAAGAGGAATATCATGAAGTACCGGGAT
CAGCTCGATGATTTCGAGTTGCTTTAG
Gene >Ophcf2|05389
ATGGTCCGCAAACTCAAATACCACGAGCAGAAGCTCCTGCGAAAAACAGATTTCATCACATACAAGCAGGACAAG
GACCATCGCGACAAGGCGGTTGCGCGACGGTACATGATCCAGAAGCCCGAGGACTACCACCGCTATAACCGCATC
TGCGGCGTGCGTTTCCCCCCCCCCCCCCCTCTTCTCTCTTCTAAGCTCTCCTTTTCTACTTCAAAAGGCATTTCT
GACGTGGAAGTGGTGGGAAAAAGTCTCTTCGGCAATTGGCACATCGCCTCACCCTCCTCCCACCGGACAACAAAA
CCCGCCAAAAGCTCGAAACGCAGCTGCTGGACAAGCTCTACGACATGGGCATCCTGTCGACGCGCACGAAGCTAT
CGTCGGTGGAAAAGGGCGCGACGGTCAGCGCCTTCGCCCGCCGTCGTCTGCCCGTCGTCATGACGAGGTTGAGGA
TGGCGCCTACTGTTCAGGCGGCTACCCGGTTGATCGAGCAGGGGCAGGTGCGCGTGGGGACGGAGCCTGTTACCG
ATCCGGCGTATTTGGTTACGAGGGGAAGGGAGGATTTCGTGACGTGGGTTGTTGGGAGTGGGGTTAAGAGGAATA
TCATGAAGTACCGGGATCAGCTCGATGATTTCGAGTTGCTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail