Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05388
Gene name
Locationscaffold_05:3559064..3559531
Strand-
Gene length (bp)467
Transcript length (bp)408
Coding sequence length (bp)408
Protein length (aa) 136

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01084 Ribosomal_S18 Ribosomal protein S18 8.3E-14 63 107

GO

GO Term Description Terminal node
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0003735 structural constituent of ribosome Yes
GO:0009058 biosynthetic process No
GO:0044238 primary metabolic process No
GO:0019538 protein metabolic process No
GO:0009059 macromolecule biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0043170 macromolecule metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0005575 cellular_component No
GO:1901576 organic substance biosynthetic process No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043229 intracellular organelle No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0043043 peptide biosynthetic process No
GO:0003674 molecular_function No
GO:0006518 peptide metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0008150 biological_process No
GO:0043226 organelle No
GO:0043228 non-membrane-bounded organelle No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0005198 structural molecule activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.2978 0.2092 0.0622 0.0074 0.8609 0.0441 0.1907 0.0235 0.0108 0.0097

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2160
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4163
Ophiocordyceps australis map64 (Brazil) OphauB2|6413
Ophiocordyceps camponoti-floridani Ophcf2|05388 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4339
Ophiocordyceps kimflemingae Ophio5|5629
Ophiocordyceps subramaniannii Hirsu2|2662

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05388
MSKTISKRQQADNLLRRMPRRFELGDLYSPHDLSPVEMFKYRNRTKRTFDVVDALRLRPRDLYKNFTLIQDFTNS
AGQIQPRSVTGLRSVNQRRIAKMIRRAQGMGIYPSIHDHPEALRNRFFAPLARWKSEGNR*
Coding >Ophcf2|05388
ATGTCAAAGACTATCTCCAAGAGGCAGCAGGCCGATAACCTTTTGAGGCGGATGCCGCGTCGTTTCGAGCTGGGT
GACCTCTACTCGCCGCACGATCTCAGCCCCGTTGAGATGTTTAAATATCGTAACAGGACGAAGCGTACGTTTGAC
GTTGTTGATGCGTTGCGTCTTCGTCCGCGGGACTTGTACAAGAACTTCACCCTCATCCAAGATTTCACCAACTCG
GCCGGCCAGATTCAGCCAAGATCCGTTACCGGCTTGCGTTCCGTCAACCAACGCAGAATCGCAAAAATGATTCGC
CGCGCCCAAGGCATGGGCATCTATCCCTCCATCCACGACCACCCCGAAGCCCTACGTAATCGCTTCTTCGCCCCC
TTAGCTCGTTGGAAATCAGAAGGCAACAGGTAG
Transcript >Ophcf2|05388
ATGTCAAAGACTATCTCCAAGAGGCAGCAGGCCGATAACCTTTTGAGGCGGATGCCGCGTCGTTTCGAGCTGGGT
GACCTCTACTCGCCGCACGATCTCAGCCCCGTTGAGATGTTTAAATATCGTAACAGGACGAAGCGTACGTTTGAC
GTTGTTGATGCGTTGCGTCTTCGTCCGCGGGACTTGTACAAGAACTTCACCCTCATCCAAGATTTCACCAACTCG
GCCGGCCAGATTCAGCCAAGATCCGTTACCGGCTTGCGTTCCGTCAACCAACGCAGAATCGCAAAAATGATTCGC
CGCGCCCAAGGCATGGGCATCTATCCCTCCATCCACGACCACCCCGAAGCCCTACGTAATCGCTTCTTCGCCCCC
TTAGCTCGTTGGAAATCAGAAGGCAACAGGTAG
Gene >Ophcf2|05388
ATGTCAAAGACTATCTCCAAGAGGCAGCAGGCCGATAACCTTTTGAGGCGGATGCCGCGTCGTTTCGAGCTGGGT
GACCTCTACTCGCCGCACGATCTCAGCCCCGTTGAGATGTTTAAATATCGTAACAGGACGAAGCGTACGTTTGAC
GTTGTTGATGCGTTGCGTCTTCGTCCGCGGGACTTGTACAAGGTGCGCGGCCACGATGCTTCTTTCAACAAATGG
CAAAATGCTAATGTTGACCATGGCAGAACTTCACCCTCATCCAAGATTTCACCAACTCGGCCGGCCAGATTCAGC
CAAGATCCGTTACCGGCTTGCGTTCCGTCAACCAACGCAGAATCGCAAAAATGATTCGCCGCGCCCAAGGCATGG
GCATCTATCCCTCCATCCACGACCACCCCGAAGCCCTACGTAATCGCTTCTTCGCCCCCTTAGCTCGTTGGAAAT
CAGAAGGCAACAGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail