Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05382
Gene name
Locationscaffold_05:3455349..3457172
Strand-
Gene length (bp)1823
Transcript length (bp)1764
Coding sequence length (bp)1764
Protein length (aa) 588

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08324 PUL PUL domain 1.6E-55 307 576
PF05903 Peptidase_C97 PPPDE putative peptidase domain 6.0E-31 2 136
PF00085 Thioredoxin Thioredoxin 2.8E-13 196 272
PF13728 TraF F plasmid transfer operon protein 2.6E-09 165 264

GO

GO Term Description Terminal node
GO:0008233 peptidase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0140096 catalytic activity, acting on a protein No
GO:0016787 hydrolase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.7652 0.6235 0.1627 0.0613 0.2399 0.11 0.1629 0.2275 0.1991 0.0553

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6061
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|05382 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4332
Ophiocordyceps kimflemingae Ophio5|2346
Ophiocordyceps subramaniannii Hirsu2|2267

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05382
MEVHLLVYDLSRGLARQMSMGLLGFQLDAMYHTSIELDGREYVYDGGIITIIPGTSHLGQPMRRTLLGTTQLPLP
VIDDYLDSIRSIFTLEAYDLFHNNCNNFTDTFSNFLVGKGIPSDIINMPQAVLASPMGRQLFSQFSQGVGAGQSN
GSILGLEQSATSVQRQPSSRAGSRHQVHVISRSEDLTRALDQAKRCCAIVFFTSATCPPCKALYPVYDELADEFG
VHVSFIKVDVSRPDAASIAKSYSISATPTFVTFLKGQQERRWTGADRAGLRGSIQLLVQMAHPAHPHERLRLPSF
SDAYVRPVLFPKVPPVAKLMARLGDDVKTNPEMQSLKVFIEKGSSHATMPDMRRLSGFIIESVAQLPSSILFAVI
DVFRCALVDVRISGYFAEEEGQKTVCRVLDSVNEHDSCPYPLRLVTLQMGCNMFSTPLFADTILGHDVLRASLIR
LISSSFLDDNHTSVRVAASSLLFNLALAYRRMRVTGTASCSSPSSNLPVDAQVELAASVVEAINQEKESADALRG
MLLALGHLTYGMDLDGELADLLRALDAQGTVTNKRGTFPSEVGIIGEVANELLGSDKGLSRP*
Coding >Ophcf2|05382
ATGGAAGTTCATCTTCTCGTCTATGACCTCTCGCGCGGCCTCGCCCGTCAAATGTCCATGGGCCTGCTGGGTTTC
CAGCTCGACGCCATGTATCACACCTCGATTGAGCTCGATGGGCGCGAATACGTCTATGACGGTGGCATCATCACC
ATTATTCCCGGAACGTCTCATTTGGGTCAGCCCATGAGAAGAACGCTGCTTGGCACCACGCAGTTGCCATTGCCT
GTCATCGACGACTATCTCGACTCGATACGGTCAATCTTTACCCTCGAGGCTTACGACCTCTTTCATAACAACTGC
AATAATTTCACGGACACTTTTTCCAACTTCCTCGTCGGCAAGGGAATCCCAAGCGACATCATCAATATGCCCCAG
GCCGTCCTTGCCTCCCCGATGGGCAGACAGCTTTTCTCGCAATTCTCGCAAGGAGTCGGCGCCGGCCAATCCAAC
GGTTCTATCCTTGGGCTCGAGCAGAGCGCCACTAGTGTTCAACGGCAGCCATCAAGCCGCGCAGGATCCAGACAT
CAGGTGCACGTCATCTCTAGATCAGAGGACCTCACCCGAGCATTGGACCAAGCGAAAAGGTGTTGCGCCATTGTG
TTCTTCACCTCAGCGACATGCCCGCCCTGCAAGGCCCTTTACCCCGTTTACGACGAGCTGGCCGACGAGTTTGGC
GTCCACGTGTCCTTTATCAAGGTCGATGTCTCCCGGCCCGACGCAGCTTCCATAGCCAAATCGTACTCGATATCG
GCCACACCCACATTTGTCACCTTTCTCAAGGGCCAGCAGGAGAGAAGATGGACGGGCGCGGATCGGGCCGGCCTT
CGAGGAAGTATCCAGCTCCTGGTACAGATGGCTCATCCTGCGCATCCACACGAGAGGCTTCGGCTACCCAGCTTC
TCCGACGCTTATGTGAGGCCTGTTCTGTTTCCCAAGGTACCCCCAGTGGCCAAGCTCATGGCCAGGCTGGGAGAC
GACGTGAAGACCAATCCGGAGATGCAGAGCCTCAAGGTATTCATCGAGAAGGGGAGCAGCCACGCTACAATGCCA
GACATGAGGAGACTGTCAGGCTTCATTATCGAATCAGTCGCACAGCTGCCCTCCAGCATCTTATTCGCCGTCATC
GACGTGTTCCGTTGTGCTCTCGTCGATGTGCGCATCAGCGGCTACTTCGCCGAGGAAGAGGGACAGAAGACTGTG
TGCCGTGTTCTCGACTCGGTAAACGAGCACGACAGCTGCCCATATCCTCTCCGGCTGGTGACGCTTCAGATGGGG
TGCAACATGTTTTCGACGCCGCTCTTCGCGGACACGATTCTCGGTCATGACGTTCTGAGGGCTTCGCTGATCCGT
CTGATATCTTCCAGTTTCCTGGACGACAACCACACGAGTGTCCGAGTAGCAGCCTCATCACTTCTCTTTAACCTG
GCGCTGGCCTACCGTCGAATGAGGGTTACCGGGACCGCATCCTGCTCCTCGCCGTCGAGCAATCTCCCGGTGGAC
GCCCAGGTCGAGCTGGCGGCGTCAGTAGTCGAGGCCATCAACCAGGAAAAGGAGTCGGCCGACGCGCTACGCGGT
ATGCTTCTGGCGCTGGGCCACTTGACCTACGGCATGGACCTCGACGGCGAGCTGGCTGATCTGCTGAGGGCGCTA
GACGCGCAGGGGACAGTAACGAATAAACGGGGGACGTTTCCATCTGAGGTTGGCATCATCGGTGAGGTTGCCAAT
GAGCTGCTTGGGAGTGATAAGGGGTTGTCGAGGCCATAG
Transcript >Ophcf2|05382
ATGGAAGTTCATCTTCTCGTCTATGACCTCTCGCGCGGCCTCGCCCGTCAAATGTCCATGGGCCTGCTGGGTTTC
CAGCTCGACGCCATGTATCACACCTCGATTGAGCTCGATGGGCGCGAATACGTCTATGACGGTGGCATCATCACC
ATTATTCCCGGAACGTCTCATTTGGGTCAGCCCATGAGAAGAACGCTGCTTGGCACCACGCAGTTGCCATTGCCT
GTCATCGACGACTATCTCGACTCGATACGGTCAATCTTTACCCTCGAGGCTTACGACCTCTTTCATAACAACTGC
AATAATTTCACGGACACTTTTTCCAACTTCCTCGTCGGCAAGGGAATCCCAAGCGACATCATCAATATGCCCCAG
GCCGTCCTTGCCTCCCCGATGGGCAGACAGCTTTTCTCGCAATTCTCGCAAGGAGTCGGCGCCGGCCAATCCAAC
GGTTCTATCCTTGGGCTCGAGCAGAGCGCCACTAGTGTTCAACGGCAGCCATCAAGCCGCGCAGGATCCAGACAT
CAGGTGCACGTCATCTCTAGATCAGAGGACCTCACCCGAGCATTGGACCAAGCGAAAAGGTGTTGCGCCATTGTG
TTCTTCACCTCAGCGACATGCCCGCCCTGCAAGGCCCTTTACCCCGTTTACGACGAGCTGGCCGACGAGTTTGGC
GTCCACGTGTCCTTTATCAAGGTCGATGTCTCCCGGCCCGACGCAGCTTCCATAGCCAAATCGTACTCGATATCG
GCCACACCCACATTTGTCACCTTTCTCAAGGGCCAGCAGGAGAGAAGATGGACGGGCGCGGATCGGGCCGGCCTT
CGAGGAAGTATCCAGCTCCTGGTACAGATGGCTCATCCTGCGCATCCACACGAGAGGCTTCGGCTACCCAGCTTC
TCCGACGCTTATGTGAGGCCTGTTCTGTTTCCCAAGGTACCCCCAGTGGCCAAGCTCATGGCCAGGCTGGGAGAC
GACGTGAAGACCAATCCGGAGATGCAGAGCCTCAAGGTATTCATCGAGAAGGGGAGCAGCCACGCTACAATGCCA
GACATGAGGAGACTGTCAGGCTTCATTATCGAATCAGTCGCACAGCTGCCCTCCAGCATCTTATTCGCCGTCATC
GACGTGTTCCGTTGTGCTCTCGTCGATGTGCGCATCAGCGGCTACTTCGCCGAGGAAGAGGGACAGAAGACTGTG
TGCCGTGTTCTCGACTCGGTAAACGAGCACGACAGCTGCCCATATCCTCTCCGGCTGGTGACGCTTCAGATGGGG
TGCAACATGTTTTCGACGCCGCTCTTCGCGGACACGATTCTCGGTCATGACGTTCTGAGGGCTTCGCTGATCCGT
CTGATATCTTCCAGTTTCCTGGACGACAACCACACGAGTGTCCGAGTAGCAGCCTCATCACTTCTCTTTAACCTG
GCGCTGGCCTACCGTCGAATGAGGGTTACCGGGACCGCATCCTGCTCCTCGCCGTCGAGCAATCTCCCGGTGGAC
GCCCAGGTCGAGCTGGCGGCGTCAGTAGTCGAGGCCATCAACCAGGAAAAGGAGTCGGCCGACGCGCTACGCGGT
ATGCTTCTGGCGCTGGGCCACTTGACCTACGGCATGGACCTCGACGGCGAGCTGGCTGATCTGCTGAGGGCGCTA
GACGCGCAGGGGACAGTAACGAATAAACGGGGGACGTTTCCATCTGAGGTTGGCATCATCGGTGAGGTTGCCAAT
GAGCTGCTTGGGAGTGATAAGGGGTTGTCGAGGCCATAG
Gene >Ophcf2|05382
ATGGAAGTTCATCTTCTCGTCTATGACCTCTCGCGCGGCCTCGCCCGTCAAATGTCCATGGGCCTGCTGGGTTTC
CAGCTCGACGCCATGTATCACACCTCGATTGAGCTCGATGGGCGCGAATACGTCTATGACGGTGGCATCATCACC
ATTATTCCCGGAACGTCTCATTTGGGTCAGCCCATGAGAAGAACGCTGCTTGGCACCACGCAGTTGCCATTGCCT
GTCATCGACGACTATCTCGACTCGATACGGTCAATCTTTACCCTCGAGGTACCTATGCCTTGATCCCTCCCTTCC
TCCTCCCAGTCGAGACTGACACTTCCATCTAGGCTTACGACCTCTTTCATAACAACTGCAATAATTTCACGGACA
CTTTTTCCAACTTCCTCGTCGGCAAGGGAATCCCAAGCGACATCATCAATATGCCCCAGGCCGTCCTTGCCTCCC
CGATGGGCAGACAGCTTTTCTCGCAATTCTCGCAAGGAGTCGGCGCCGGCCAATCCAACGGTTCTATCCTTGGGC
TCGAGCAGAGCGCCACTAGTGTTCAACGGCAGCCATCAAGCCGCGCAGGATCCAGACATCAGGTGCACGTCATCT
CTAGATCAGAGGACCTCACCCGAGCATTGGACCAAGCGAAAAGGTGTTGCGCCATTGTGTTCTTCACCTCAGCGA
CATGCCCGCCCTGCAAGGCCCTTTACCCCGTTTACGACGAGCTGGCCGACGAGTTTGGCGTCCACGTGTCCTTTA
TCAAGGTCGATGTCTCCCGGCCCGACGCAGCTTCCATAGCCAAATCGTACTCGATATCGGCCACACCCACATTTG
TCACCTTTCTCAAGGGCCAGCAGGAGAGAAGATGGACGGGCGCGGATCGGGCCGGCCTTCGAGGAAGTATCCAGC
TCCTGGTACAGATGGCTCATCCTGCGCATCCACACGAGAGGCTTCGGCTACCCAGCTTCTCCGACGCTTATGTGA
GGCCTGTTCTGTTTCCCAAGGTACCCCCAGTGGCCAAGCTCATGGCCAGGCTGGGAGACGACGTGAAGACCAATC
CGGAGATGCAGAGCCTCAAGGTATTCATCGAGAAGGGGAGCAGCCACGCTACAATGCCAGACATGAGGAGACTGT
CAGGCTTCATTATCGAATCAGTCGCACAGCTGCCCTCCAGCATCTTATTCGCCGTCATCGACGTGTTCCGTTGTG
CTCTCGTCGATGTGCGCATCAGCGGCTACTTCGCCGAGGAAGAGGGACAGAAGACTGTGTGCCGTGTTCTCGACT
CGGTAAACGAGCACGACAGCTGCCCATATCCTCTCCGGCTGGTGACGCTTCAGATGGGGTGCAACATGTTTTCGA
CGCCGCTCTTCGCGGACACGATTCTCGGTCATGACGTTCTGAGGGCTTCGCTGATCCGTCTGATATCTTCCAGTT
TCCTGGACGACAACCACACGAGTGTCCGAGTAGCAGCCTCATCACTTCTCTTTAACCTGGCGCTGGCCTACCGTC
GAATGAGGGTTACCGGGACCGCATCCTGCTCCTCGCCGTCGAGCAATCTCCCGGTGGACGCCCAGGTCGAGCTGG
CGGCGTCAGTAGTCGAGGCCATCAACCAGGAAAAGGAGTCGGCCGACGCGCTACGCGGTATGCTTCTGGCGCTGG
GCCACTTGACCTACGGCATGGACCTCGACGGCGAGCTGGCTGATCTGCTGAGGGCGCTAGACGCGCAGGGGACAG
TAACGAATAAACGGGGGACGTTTCCATCTGAGGTTGGCATCATCGGTGAGGTTGCCAATGAGCTGCTTGGGAGTG
ATAAGGGGTTGTCGAGGCCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail