Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05377
Gene name
Locationscaffold_05:3443506..3444732
Strand-
Gene length (bp)1226
Transcript length (bp)1179
Coding sequence length (bp)1179
Protein length (aa) 393

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02492 cobW CobW/HypB/UreG, nucleotide-binding domain 2.2E-39 35 212

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6675 0.5209 0.0773 0.0204 0.3127 0.0454 0.227 0.0869 0.16 0.0661

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2012
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1345
Ophiocordyceps australis map64 (Brazil) OphauB2|6020
Ophiocordyceps camponoti-floridani Ophcf2|05377 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4327
Ophiocordyceps kimflemingae Ophio5|2351
Ophiocordyceps subramaniannii Hirsu2|2261

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05377
MIKPRHVKPTLRKSPSKPPPNDHPNPSHHAPPPIPITIITGFLGSGKTTLILSLIPQLLSRTPTYRLALIKNEFG
DVAVDSQLASTAAITGVRELLGGCICCNLVGSLATALTELERDVRPDRIVIETSGSAFPATLALEVNRLARETGR
YLLDGVVSVIDVENWKGYEDTSYTARLQARYTDLVVFNKWEEAGEQRYEECLDRLGDLEVEVATVKSKRGSVDAD
VIFGIDHSLAHRLTNAEAEAEPPTHTHTHNHQSEVQVLSVELRTPPPSPPTAASLPSLIKLLKAAPKDEVYRIKA
IVSLSSTPRNSDEDVPAPDASARRYILNWAFGRWTFTALPDDQNAGDEGLVLHMTLILARYEADKWKKRLETGGL
VESEEGGEAVLTVKRLL*
Coding >Ophcf2|05377
ATGATCAAACCTCGACACGTGAAACCAACCCTCCGAAAGTCACCATCAAAACCCCCCCCCAATGACCACCCCAAT
CCATCCCACCATGCCCCCCCCCCAATCCCAATAACCATAATAACCGGCTTCCTCGGCTCCGGCAAAACAACCCTG
ATCCTCTCCCTCATCCCCCAACTCCTCTCCCGCACCCCAACCTACCGCCTCGCCCTCATCAAGAACGAATTCGGC
GACGTGGCCGTAGACTCCCAGCTGGCCTCCACGGCCGCCATCACCGGCGTCCGCGAACTTCTCGGCGGCTGCATC
TGCTGCAACCTCGTCGGCAGCCTCGCCACCGCCCTGACCGAGCTCGAGCGCGACGTCCGGCCCGATAGAATCGTC
ATCGAGACGAGCGGGTCCGCGTTCCCGGCCACGCTCGCGCTGGAAGTGAATCGGCTTGCGCGCGAAACGGGACGG
TACCTTCTCGACGGTGTCGTTTCCGTCATCGACGTTGAGAATTGGAAGGGCTACGAGGATACCAGCTACACTGCG
CGACTGCAGGCTCGGTACACAGATCTCGTCGTCTTTAACAAGTGGGAAGAAGCAGGCGAGCAGCGATACGAAGAA
TGCCTCGATAGACTCGGAGATCTAGAAGTCGAAGTCGCCACCGTCAAGAGTAAGCGAGGCTCCGTCGACGCAGAC
GTCATCTTCGGCATAGACCACAGCCTCGCCCACCGCCTAACAAACGCCGAAGCCGAAGCCGAACCACCAACCCAC
ACCCACACCCACAACCACCAATCCGAAGTCCAAGTCCTTTCCGTCGAGCTCCGAACCCCGCCTCCCTCCCCCCCC
ACAGCAGCATCCCTCCCCTCCCTCATCAAGCTCCTCAAGGCGGCGCCCAAGGACGAAGTCTACCGCATCAAAGCC
ATTGTCAGCCTCTCTTCTACGCCGCGGAACTCGGACGAGGACGTCCCGGCTCCCGATGCCTCGGCCCGTCGGTAC
ATTCTGAACTGGGCGTTCGGCCGCTGGACATTTACAGCCCTTCCAGACGATCAGAATGCTGGTGACGAGGGCTTG
GTGCTGCATATGACGCTCATCCTCGCCAGATACGAGGCTGATAAGTGGAAGAAGAGGCTCGAGACTGGTGGGCTC
GTCGAGTCGGAGGAGGGAGGGGAGGCGGTGCTAACTGTCAAGAGGCTTCTGTAG
Transcript >Ophcf2|05377
ATGATCAAACCTCGACACGTGAAACCAACCCTCCGAAAGTCACCATCAAAACCCCCCCCCAATGACCACCCCAAT
CCATCCCACCATGCCCCCCCCCCAATCCCAATAACCATAATAACCGGCTTCCTCGGCTCCGGCAAAACAACCCTG
ATCCTCTCCCTCATCCCCCAACTCCTCTCCCGCACCCCAACCTACCGCCTCGCCCTCATCAAGAACGAATTCGGC
GACGTGGCCGTAGACTCCCAGCTGGCCTCCACGGCCGCCATCACCGGCGTCCGCGAACTTCTCGGCGGCTGCATC
TGCTGCAACCTCGTCGGCAGCCTCGCCACCGCCCTGACCGAGCTCGAGCGCGACGTCCGGCCCGATAGAATCGTC
ATCGAGACGAGCGGGTCCGCGTTCCCGGCCACGCTCGCGCTGGAAGTGAATCGGCTTGCGCGCGAAACGGGACGG
TACCTTCTCGACGGTGTCGTTTCCGTCATCGACGTTGAGAATTGGAAGGGCTACGAGGATACCAGCTACACTGCG
CGACTGCAGGCTCGGTACACAGATCTCGTCGTCTTTAACAAGTGGGAAGAAGCAGGCGAGCAGCGATACGAAGAA
TGCCTCGATAGACTCGGAGATCTAGAAGTCGAAGTCGCCACCGTCAAGAGTAAGCGAGGCTCCGTCGACGCAGAC
GTCATCTTCGGCATAGACCACAGCCTCGCCCACCGCCTAACAAACGCCGAAGCCGAAGCCGAACCACCAACCCAC
ACCCACACCCACAACCACCAATCCGAAGTCCAAGTCCTTTCCGTCGAGCTCCGAACCCCGCCTCCCTCCCCCCCC
ACAGCAGCATCCCTCCCCTCCCTCATCAAGCTCCTCAAGGCGGCGCCCAAGGACGAAGTCTACCGCATCAAAGCC
ATTGTCAGCCTCTCTTCTACGCCGCGGAACTCGGACGAGGACGTCCCGGCTCCCGATGCCTCGGCCCGTCGGTAC
ATTCTGAACTGGGCGTTCGGCCGCTGGACATTTACAGCCCTTCCAGACGATCAGAATGCTGGTGACGAGGGCTTG
GTGCTGCATATGACGCTCATCCTCGCCAGATACGAGGCTGATAAGTGGAAGAAGAGGCTCGAGACTGGTGGGCTC
GTCGAGTCGGAGGAGGGAGGGGAGGCGGTGCTAACTGTCAAGAGGCTTCTGTAG
Gene >Ophcf2|05377
ATGATGTAATCATTCCAACCGACGTCAGCACCCGATAAGATAACACCGACAGCAAACCTCGACACGTGAAACCAA
CCCTCCGAAAGTCACCATCAAAACCCCCCCCCAATGACCACCCCAATCCATCCCACCATGCCCCCCCCCCAATCC
CAATAACCATAATAACCGGCTTCCTCGGCTCCGGCAAAACAACCCTGATCCTCTCCCTCATCCCCCAACTCCTCT
CCCGCACCCCAACCTACCGCCTCGCCCTCATCAAGAACGAATTCGGCGACGTGGCCGTAGACTCCCAGCTGGCCT
CCACGGCCGCCATCACCGGCGTCCGCGAACTTCTCGGCGGCTGCATCTGCTGCAACCTCGTCGGCAGCCTCGCCA
CCGCCCTGACCGAGCTCGAGCGCGACGTCCGGCCCGATAGAATCGTCATCGAGACGAGCGGGTCCGCGTTCCCGG
CCACGCTCGCGCTGGAAGTGAATCGGCTTGCGCGCGAAACGGGACGGTACCTTCTCGACGGTGTCGTTTCCGTCA
TCGACGTTGAGAATTGGAAGGGCTACGAGGATACCAGCTACACTGCGCGACTGCAGGCTCGGTACACAGATCTCG
TCGTCTTTAACAAGTGGGAAGAAGCAGGCGAGCAGCGATACGAAGAATGCCTCGATAGACTCGGAGATCTAGAAG
TCGAAGTCGCCACCGTCAAGAGTAAGCGAGGCTCCGTCGACGCAGACGTCATCTTCGGCATAGACCACAGCCTCG
CCCACCGCCTAACAAACGCCGAAGCCGAAGCCGAACCACCAACCCACACCCACACCCACAACCACCAATCCGAAG
TCCAAGTCCTTTCCGTCGAGCTCCGAACCCCGCCTCCCTCCCCCCCCACAGCAGCATCCCTCCCCTCCCTCATCA
AGCTCCTCAAGGCGGCGCCCAAGGACGAAGTCTACCGCATCAAAGCCATTGTCAGCCTCTCTTCTACGCCGCGGA
ACTCGGACGAGGACGTCCCGGCTCCCGATGCCTCGGCCCGTCGGTACATTCTGAACTGGGCGTTCGGCCGCTGGA
CATTTACAGCCCTTCCAGACGATCAGAATGCTGGTGACGAGGGCTTGGTGCTGCATATGACGCTCATCCTCGCCA
GATACGAGGCTGATAAGTGGAAGAAGAGGCTCGAGACTGGTGGGCTCGTCGAGTCGGAGGAGGGAGGGGAGGCGG
TGCTAACTGTCAAGAGGCTTCTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail