Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05375
Gene name
Locationscaffold_05:3435520..3437831
Strand-
Gene length (bp)2311
Transcript length (bp)2253
Coding sequence length (bp)2253
Protein length (aa) 751

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 8.6E-83 349 731

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 380 402 22
2 423 445 22
3 465 484 19
4 491 513 22
5 533 552 19
6 565 587 22
7 611 633 22
8 654 671 17
9 677 699 22
10 712 734 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05375
MSSPKNQMPSFGLSSSPAAGPARSFSSSIPRGELTARLAEPICSGQRSASPAGGLGLPDVDSPLADGRQQAQGPG
VSALAAALSDSLGKSPPRFGTPPARAASPPPRPTSPTLPLRTDTPTNYGSFDSRSRPCQGGVVGPYEDPEIVRRH
LVQPGESENLPSEESSTQGRGKQSIEPGAGLNDDEFSSLRLQGGDITRGIYKWTELAGAKGRLHRSRSFDHQRPE
PETEVLDINSIKVPGGFRRNHLRRNAMSPNRQVEADESGAESPPGTQPRLFTSSFLEFLTIYGHFAGEELEEDDE
ALGPNEEFWSDRAGPGDDSDDEREPMEDSALLTQSKRMRRRKPRGGSGKNSPMNAALLLLKSFVGTGVLFLPRAY
LSGGMLLSNLVLLCLAGLSYYSFVLLVSTRNNVEGSFGDMGGILYGKWMRTLILTSIVISQIGFTAAYTVFTAEN
LQAFISAVSDCRSTISIPWLILLQTLIFLPFSLLRDIGKLGFTALIADAFILIGLAYLFYYDVLTLTKFGLADII
MFNDKDWTLFIGTAIFTFEGIGLVIPIQESMKHPQKFPRVLFYVMIIITVVFVTMGAISYAAYGSKTETVVLLNL
PQDDKLVNGVQLLYSVAILLSTPLQIFPAVRIVETELFTRSGKYNPYIKWQKNICRFFVVTLCAAISWGGANNLD
KFVALVGNFACIPLVYIYPPLLHYRAVARNRAWKIADVVLCVFGFFAMAYATSLTIMSWANAGAKPPGYCERRHL
*
Coding >Ophcf2|05375
ATGTCCTCGCCCAAGAATCAAATGCCGTCTTTCGGGCTGTCATCGTCCCCAGCAGCAGGACCTGCCCGATCCTTT
TCTTCCTCGATCCCGCGCGGGGAGCTCACCGCCCGTCTCGCCGAGCCCATCTGCTCCGGGCAGCGCAGCGCGTCG
CCGGCCGGCGGCCTGGGGCTTCCCGACGTCGACTCTCCCCTCGCCGACGGCCGTCAGCAAGCTCAGGGCCCCGGC
GTTTCTGCTCTGGCAGCTGCCTTGTCTGATTCTCTCGGCAAGTCGCCACCGCGCTTCGGGACGCCTCCTGCGAGG
GCCGCCTCACCGCCGCCGCGACCGACGTCTCCCACGCTCCCCCTCCGAACCGACACACCTACCAATTACGGCTCC
TTTGACTCGAGATCTCGTCCGTGTCAGGGTGGCGTCGTCGGGCCCTATGAAGACCCGGAAATTGTGAGGCGCCAT
CTGGTGCAACCCGGCGAGTCTGAAAATCTGCCCTCGGAGGAATCGTCCACGCAGGGGCGCGGGAAACAGTCGATC
GAACCCGGCGCCGGCCTCAACGATGACGAGTTCTCCAGCTTGCGGCTCCAGGGAGGTGACATCACCCGGGGTATC
TATAAATGGACGGAACTTGCCGGGGCCAAGGGACGGCTCCATCGCAGCCGGAGCTTCGACCACCAACGGCCCGAA
CCGGAGACGGAAGTCTTGGATATCAACTCCATCAAGGTTCCGGGTGGCTTCCGGAGGAATCATCTTCGTCGAAAC
GCCATGAGTCCTAACCGCCAAGTTGAGGCTGATGAGTCGGGCGCCGAATCTCCGCCTGGGACCCAGCCGAGGCTC
TTCACATCGAGCTTTCTCGAATTTCTCACCATCTATGGCCACTTTGCGGGTGAGGAGCTCGAAGAAGACGATGAA
GCCCTCGGTCCCAATGAGGAGTTTTGGTCGGACCGAGCGGGACCCGGCGACGATAGCGACGACGAACGGGAGCCC
ATGGAGGACAGCGCACTGCTCACGCAGTCCAAGAGGATGCGGCGGCGCAAGCCCCGCGGTGGCAGCGGCAAGAAT
AGCCCTATGAATGCGGCCCTCTTGCTGCTCAAGTCCTTTGTCGGCACAGGGGTGCTGTTCCTCCCACGCGCCTAT
CTCAGCGGCGGCATGCTGCTCAGCAACCTGGTTTTGCTGTGCCTGGCCGGCCTGAGCTACTACAGCTTCGTGTTG
CTGGTTTCGACGCGGAACAACGTTGAGGGCTCCTTTGGCGACATGGGCGGAATCCTGTACGGCAAATGGATGCGA
ACACTGATCCTGACGTCCATCGTCATCAGCCAGATCGGCTTCACCGCAGCCTATACCGTCTTTACCGCCGAGAAC
CTGCAGGCCTTCATTAGCGCCGTTTCCGACTGCCGCTCAACGATCAGCATTCCGTGGTTGATCCTATTGCAGACA
CTCATTTTCCTTCCCTTTTCGTTACTTCGGGACATTGGCAAGCTGGGCTTTACAGCGCTCATTGCCGACGCCTTC
ATTCTTATCGGACTGGCCTACCTCTTCTACTACGACGTTTTGACGCTCACCAAGTTTGGACTCGCCGACATCATC
ATGTTCAACGACAAGGACTGGACCTTGTTCATCGGTACGGCAATCTTTACCTTTGAGGGTATCGGCCTGGTCATC
CCGATTCAGGAGTCGATGAAGCATCCGCAAAAGTTTCCTCGCGTCCTTTTCTATGTCATGATCATCATTACCGTC
GTCTTCGTTACCATGGGCGCCATCTCGTACGCCGCTTACGGGTCCAAGACGGAGACGGTTGTGCTACTCAACCTA
CCGCAAGATGACAAGCTGGTCAACGGCGTTCAGCTGCTCTACTCGGTTGCCATCCTGCTCTCGACGCCGCTTCAG
ATCTTTCCTGCAGTTCGCATTGTCGAGACGGAACTATTTACGCGGAGCGGTAAATATAATCCTTACATCAAGTGG
CAGAAGAACATCTGCCGCTTCTTCGTCGTCACGCTGTGTGCCGCTATTTCGTGGGGTGGCGCCAACAATCTGGAC
AAGTTCGTGGCGCTGGTTGGCAACTTTGCCTGCATCCCACTGGTCTACATCTACCCGCCGCTTCTGCACTACAGA
GCCGTTGCGAGAAACCGGGCGTGGAAGATTGCCGACGTGGTGTTGTGCGTGTTTGGCTTCTTCGCCATGGCGTAC
GCCACCAGCCTGACCATTATGAGCTGGGCCAACGCCGGGGCCAAGCCGCCGGGCTACTGCGAGAGGAGGCACCTA
TAG
Transcript >Ophcf2|05375
ATGTCCTCGCCCAAGAATCAAATGCCGTCTTTCGGGCTGTCATCGTCCCCAGCAGCAGGACCTGCCCGATCCTTT
TCTTCCTCGATCCCGCGCGGGGAGCTCACCGCCCGTCTCGCCGAGCCCATCTGCTCCGGGCAGCGCAGCGCGTCG
CCGGCCGGCGGCCTGGGGCTTCCCGACGTCGACTCTCCCCTCGCCGACGGCCGTCAGCAAGCTCAGGGCCCCGGC
GTTTCTGCTCTGGCAGCTGCCTTGTCTGATTCTCTCGGCAAGTCGCCACCGCGCTTCGGGACGCCTCCTGCGAGG
GCCGCCTCACCGCCGCCGCGACCGACGTCTCCCACGCTCCCCCTCCGAACCGACACACCTACCAATTACGGCTCC
TTTGACTCGAGATCTCGTCCGTGTCAGGGTGGCGTCGTCGGGCCCTATGAAGACCCGGAAATTGTGAGGCGCCAT
CTGGTGCAACCCGGCGAGTCTGAAAATCTGCCCTCGGAGGAATCGTCCACGCAGGGGCGCGGGAAACAGTCGATC
GAACCCGGCGCCGGCCTCAACGATGACGAGTTCTCCAGCTTGCGGCTCCAGGGAGGTGACATCACCCGGGGTATC
TATAAATGGACGGAACTTGCCGGGGCCAAGGGACGGCTCCATCGCAGCCGGAGCTTCGACCACCAACGGCCCGAA
CCGGAGACGGAAGTCTTGGATATCAACTCCATCAAGGTTCCGGGTGGCTTCCGGAGGAATCATCTTCGTCGAAAC
GCCATGAGTCCTAACCGCCAAGTTGAGGCTGATGAGTCGGGCGCCGAATCTCCGCCTGGGACCCAGCCGAGGCTC
TTCACATCGAGCTTTCTCGAATTTCTCACCATCTATGGCCACTTTGCGGGTGAGGAGCTCGAAGAAGACGATGAA
GCCCTCGGTCCCAATGAGGAGTTTTGGTCGGACCGAGCGGGACCCGGCGACGATAGCGACGACGAACGGGAGCCC
ATGGAGGACAGCGCACTGCTCACGCAGTCCAAGAGGATGCGGCGGCGCAAGCCCCGCGGTGGCAGCGGCAAGAAT
AGCCCTATGAATGCGGCCCTCTTGCTGCTCAAGTCCTTTGTCGGCACAGGGGTGCTGTTCCTCCCACGCGCCTAT
CTCAGCGGCGGCATGCTGCTCAGCAACCTGGTTTTGCTGTGCCTGGCCGGCCTGAGCTACTACAGCTTCGTGTTG
CTGGTTTCGACGCGGAACAACGTTGAGGGCTCCTTTGGCGACATGGGCGGAATCCTGTACGGCAAATGGATGCGA
ACACTGATCCTGACGTCCATCGTCATCAGCCAGATCGGCTTCACCGCAGCCTATACCGTCTTTACCGCCGAGAAC
CTGCAGGCCTTCATTAGCGCCGTTTCCGACTGCCGCTCAACGATCAGCATTCCGTGGTTGATCCTATTGCAGACA
CTCATTTTCCTTCCCTTTTCGTTACTTCGGGACATTGGCAAGCTGGGCTTTACAGCGCTCATTGCCGACGCCTTC
ATTCTTATCGGACTGGCCTACCTCTTCTACTACGACGTTTTGACGCTCACCAAGTTTGGACTCGCCGACATCATC
ATGTTCAACGACAAGGACTGGACCTTGTTCATCGGTACGGCAATCTTTACCTTTGAGGGTATCGGCCTGGTCATC
CCGATTCAGGAGTCGATGAAGCATCCGCAAAAGTTTCCTCGCGTCCTTTTCTATGTCATGATCATCATTACCGTC
GTCTTCGTTACCATGGGCGCCATCTCGTACGCCGCTTACGGGTCCAAGACGGAGACGGTTGTGCTACTCAACCTA
CCGCAAGATGACAAGCTGGTCAACGGCGTTCAGCTGCTCTACTCGGTTGCCATCCTGCTCTCGACGCCGCTTCAG
ATCTTTCCTGCAGTTCGCATTGTCGAGACGGAACTATTTACGCGGAGCGGTAAATATAATCCTTACATCAAGTGG
CAGAAGAACATCTGCCGCTTCTTCGTCGTCACGCTGTGTGCCGCTATTTCGTGGGGTGGCGCCAACAATCTGGAC
AAGTTCGTGGCGCTGGTTGGCAACTTTGCCTGCATCCCACTGGTCTACATCTACCCGCCGCTTCTGCACTACAGA
GCCGTTGCGAGAAACCGGGCGTGGAAGATTGCCGACGTGGTGTTGTGCGTGTTTGGCTTCTTCGCCATGGCGTAC
GCCACCAGCCTGACCATTATGAGCTGGGCCAACGCCGGGGCCAAGCCGCCGGGCTACTGCGAGAGGAGGCACCTA
TAG
Gene >Ophcf2|05375
ATGTCCTCGCCCAAGAATCAAATGCCGTCTTTCGGGCTGTCATCGTCCCCAGCAGCAGGACCTGCCCGATCCTTT
TCTTCCTCGATCCCGCGCGGGGAGCTCACCGCCCGTCTCGCCGAGCCCATCTGCTCCGGGCAGCGCAGCGCGTCG
CCGGCCGGCGGCCTGGGGCTTCCCGACGTCGACTCTCCCCTCGCCGACGGCCGTCAGCAAGCTCAGGGCCCCGGC
GTTTCTGCTCTGGCAGCTGCCTTGTCTGATTCTCTCGGCAAGTCGCCACCGCGCTTCGGGACGCCTCCTGCGAGG
GCCGCCTCACCGCCGCCGCGACCGACGTCTCCCACGCTCCCCCTCCGAACCGACACACCTACCAATTACGGCTCC
TTTGACTCGAGATCTCGTCCGTGTCAGGGTGGCGTCGTCGGGCCCTATGAAGACCCGGAAATTGTGAGGCGCCAT
CTGGTGCAACCCGGCGAGTCTGAAAATCTGCCCTCGGAGGAATCGTCCACGCAGGGGCGCGGGAAACAGTCGATC
GAACCCGGCGCCGGCCTCAACGATGACGAGTTCTCCAGCTTGCGGCTCCAGGGAGGTGACATCACCCGGGGTATC
TATAAATGGACGGAACTTGCCGGGGCCAAGGGACGGCTCCATCGCAGCCGGAGCTTCGACCACCAACGGCCCGAA
CCGGAGACGGAAGTCTTGGATATCAACTCCATCAAGGTTCCGGGTGGCTTCCGGAGGAATCATCTTCGTCGAAAC
GCCATGAGTCCTAACCGCCAAGTTGAGGCTGATGAGTCGGGCGCCGAATCTCCGCCTGGGACCCAGCCGAGGCTC
TTCACATCGAGCTTTCTCGAATTTCTCACCATCTATGGCCACTTTGCGGGTGAGGAGCTCGAAGAAGACGATGAA
GCCCTCGGTCCCAATGAGGAGTTTTGGTCGGACCGAGCGGGACCCGGCGACGATAGCGACGACGAACGGGAGCCC
ATGGAGGACAGCGCACTGCTCACGCAGTCCAAGAGGATGCGGCGGCGCAAGCCCCGCGGTGGCAGCGGCAAGAAT
AGCCCTATGAATGCGGCCCTCTTGCTGCTCAAGTCCTTTGTCGGCACAGGGGTGCTGTTCCTCCCACGCGCCTAT
CTCAGCGGCGGCATGCTGCTCAGCAACCTGGTTTTGCTGTGCCTGGCCGGCCTGAGCTACTACAGCTTCGTGTTG
CTGGTTTCGACGCGGAACAACGTTGAGGGCTCCTTTGGCGACATGGGCGGAATCCTGTACGGCAAATGGATGCGA
ACACTGATCCTGACGTCCATCGTCATCAGCCAGATCGGCTTCACCGCAGCCTATACCGTCTTTACCGCCGAGAAC
CTGCAGGCCTTCATTAGCGCCGTTTCCGACTGCCGCTCAACGATCAGCATTCCGTGGTTGATCCTATTGCAGACA
CTCATTTTCCTTCCCTTTTCGTTACTTCGGGACATTGGCAAGCTGGGCTTTACAGCGCTCATTGCCGACGCCTTC
ATTCTTATCGGACTGGCCTACCTCTTCTACTACGACGTTTTGACGCTCACCAAGTTTGGACTCGCCGACATCATC
ATGTTCAACGACAAGGACTGGACCTTGTTCATCGGTACGGCAATCTTTACCTTTGAGGGTATCGGCCTGGTCATC
CCGATTCAGGAGTCGATGAAGCATCCGCAAAAGTTTCCTCGCGTCCTTTTCTATGTCATGATCATCATTACCGTC
GTCTTCGTTACCATGGGCGCCATCTCGTACGCCGCTTACGGGTCCAAGACGGAGACGGTTGTGCTACTCAACCTA
CCGCAAGATGACAAGCTGGTCAACGGCGTTCAGCTGCTCTACTCGGTTGCCATCCTGCTCTCGACGCCGCTTCAG
ATCTTTCCTGCAGTTCGCATTGTCGAGACGGAACTATTTACGCGGAGCGGTAAATATAATCCTTACATCAAGTGG
CAGAAGAACATCTGCCGCTTCTTCGTCGTCACGCTGTGTGCCGCTATTTCGTGGGGTGGCGCCAACAATCTGGAC
AAGTTCGTGGCGCTGGTTGGCAACTTTGCCTGCATCCCACTGGTCTACATCTACCCGGTAAGGACGCTCATAGCG
ATCGAGGCGAGGGTACGGTCGCTAACACTCAACTAAATAGCCGCTTCTGCACTACAGAGCCGTTGCGAGAAACCG
GGCGTGGAAGATTGCCGACGTGGTGTTGTGCGTGTTTGGCTTCTTCGCCATGGCGTACGCCACCAGCCTGACCAT
TATGAGCTGGGCCAACGCCGGGGCCAAGCCGCCGGGCTACTGCGAGAGGAGGCACCTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail