Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05373
Gene name
Locationscaffold_05:3431274..3432020
Strand-
Gene length (bp)746
Transcript length (bp)684
Coding sequence length (bp)684
Protein length (aa) 228

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

Domain # Start End Length
1 172 194 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 0.00 0.00 0.00
Alive In ants, during behavior modification 10.07 1.81 18.32
Dead In ants, recently dead 2.93 0.25 5.62

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.000238 yes
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05373
MACFYKDGRPAINGAYYPCRNGVVFNATSATAAFNATGLRMCCEPKGPDRCLPNGLCDIPGERGYLYRGACDNPR
GDGCRSICPEVNPYSWTEVKLCEPGVYCCGPDKNAERARDCCSNRSARFLLPDLEVMSGSKLNGFTGSPSTASST
TQASSPTSSPNTSKPSSPSAAVIAGPVVGGAVALALLVVAILLFRRSRQKRRQWTPSEQKSPPVEVDGRLRPGEL
AG*
Coding >Ophcf2|05373
ATGGCTTGCTTCTACAAGGACGGCAGGCCGGCCATCAACGGAGCCTACTACCCGTGCCGCAACGGTGTCGTCTTC
AACGCTACTTCCGCGACGGCCGCCTTCAACGCTACGGGGTTGCGCATGTGCTGTGAGCCCAAGGGGCCTGATCGC
TGCTTGCCGAATGGGCTTTGCGACATTCCGGGGGAGAGGGGATATCTCTACCGCGGGGCGTGTGATAATCCCCGA
GGCGATGGCTGTCGCAGTATCTGTCCTGAGGTCAATCCATATTCTTGGACAGAGGTCAAGCTCTGCGAGCCTGGA
GTCTACTGCTGCGGCCCAGACAAGAACGCCGAGAGGGCTAGAGACTGCTGTTCCAACCGCTCAGCTCGCTTTCTA
CTACCCGACCTCGAGGTCATGTCGGGCTCCAAGTTAAACGGCTTCACCGGCTCTCCATCAACAGCCTCCTCTACC
ACCCAGGCTTCGTCACCGACGTCCTCTCCAAACACGTCAAAACCTTCGTCCCCTTCCGCAGCCGTCATTGCCGGG
CCCGTTGTCGGAGGCGCCGTTGCTCTCGCTCTACTTGTCGTCGCCATATTGCTCTTTCGGAGATCACGGCAAAAG
AGGAGGCAGTGGACGCCGTCGGAGCAAAAGTCACCACCGGTCGAGGTGGATGGAAGGCTGCGGCCAGGCGAGTTG
GCTGGTTGA
Transcript >Ophcf2|05373
ATGGCTTGCTTCTACAAGGACGGCAGGCCGGCCATCAACGGAGCCTACTACCCGTGCCGCAACGGTGTCGTCTTC
AACGCTACTTCCGCGACGGCCGCCTTCAACGCTACGGGGTTGCGCATGTGCTGTGAGCCCAAGGGGCCTGATCGC
TGCTTGCCGAATGGGCTTTGCGACATTCCGGGGGAGAGGGGATATCTCTACCGCGGGGCGTGTGATAATCCCCGA
GGCGATGGCTGTCGCAGTATCTGTCCTGAGGTCAATCCATATTCTTGGACAGAGGTCAAGCTCTGCGAGCCTGGA
GTCTACTGCTGCGGCCCAGACAAGAACGCCGAGAGGGCTAGAGACTGCTGTTCCAACCGCTCAGCTCGCTTTCTA
CTACCCGACCTCGAGGTCATGTCGGGCTCCAAGTTAAACGGCTTCACCGGCTCTCCATCAACAGCCTCCTCTACC
ACCCAGGCTTCGTCACCGACGTCCTCTCCAAACACGTCAAAACCTTCGTCCCCTTCCGCAGCCGTCATTGCCGGG
CCCGTTGTCGGAGGCGCCGTTGCTCTCGCTCTACTTGTCGTCGCCATATTGCTCTTTCGGAGATCACGGCAAAAG
AGGAGGCAGTGGACGCCGTCGGAGCAAAAGTCACCACCGGTCGAGGTGGATGGAAGGCTGCGGCCAGGCGAGTTG
GCTGGTTGA
Gene >Ophcf2|05373
ATGGCTTGCTTCTACAAGGACGGCAGGCCGGCCATCAACGGAGCCTACTACCCGTGCCGCAACGGTGTCGTCTTC
AACGCTACTTCCGCGACGGCCGCCTTCAACGCTACGGGGTTGCGCATGTGCTGTGAGCCCAAGGGGCCTGATCGC
TGCTTGCCGAATGGGCTTTGCGACATTCCGGGGGAGAGGGGATATCTCTACCGCGGGGCGTGTGATAATCCCCGA
GGCGATGGCTGTCGCAGTATCTGTCCTGAGGGTTCGTACCTCTTATCTTCTTCTTGTTTAAATTACCCCTAACGT
TGTTCTCGTCGGTTGCAGTCAATCCATATTCTTGGACAGAGGTCAAGCTCTGCGAGCCTGGAGTCTACTGCTGCG
GCCCAGACAAGAACGCCGAGAGGGCTAGAGACTGCTGTTCCAACCGCTCAGCTCGCTTTCTACTACCCGACCTCG
AGGTCATGTCGGGCTCCAAGTTAAACGGCTTCACCGGCTCTCCATCAACAGCCTCCTCTACCACCCAGGCTTCGT
CACCGACGTCCTCTCCAAACACGTCAAAACCTTCGTCCCCTTCCGCAGCCGTCATTGCCGGGCCCGTTGTCGGAG
GCGCCGTTGCTCTCGCTCTACTTGTCGTCGCCATATTGCTCTTTCGGAGATCACGGCAAAAGAGGAGGCAGTGGA
CGCCGTCGGAGCAAAAGTCACCACCGGTCGAGGTGGATGGAAGGCTGCGGCCAGGCGAGTTGGCTGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail